SecReT6
Protein ID: 197337884
SecReT6 ID300
T6SS typei1
Gene symbol-
Locus tagVFMJ11_A0822
StrainVibrio fischeri MJ11
Repliconchromosome II [GenBank: NC_011186] [Browse all T6SS(s) in this replicon]
Location [Strand]906575..908053 [-]
Producttype VI secretion protein, EvpB/family
NoteTssC
UniProt IDB5EUK3
KEGG IDvfm:VFMJ11_A0822
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.30E-185, Aligned region: 66..490
Protein Sequence: 492 a.a.     [Download]
>gi|197337884|ref|YP_002158371.1| type VI secretion protein, EvpB/family [Vibrio fischeri MJ11]
MTAEAQAPEQEAAIVESGSLLDSILNETRLKPSDEGFDVAKRGVEAFIGELLSTNTSDKVDQSLVDLMIS
EIDQKLSKQVDAILHNEEVQAIESTWRGLKYLVDHTDFRENIQIELISAKKDEVLDDFEDAPEVVKSGLY
KQIYTREYGQFGGKPVGAVICDFQMSASSPDIKLMEYMANVGAMSHAPFITSASAKFFGLDSYEELPNLK
DLKSVFEGPQYTKWRGFREHEDARYVGLCTSRMMLRTPYSVEDNPIKAFDYNEHVKDGHDNYLWGNSAYA
MASKISESFAKYRWCPNIIGPQSGGTVSDLPVYNYESMGQIETKIPTEILISDRREYELAEEGFIALTMR
KGSDNAAFFSANSVQKAKVFPNTPEGQQAEMNYKLGIQLPYMFIINRLAHYIKVLQREQIGSWKERSDLE
IELNKWIRQYVSDQENPPAEVRGRRPLRAAKVEVSEVEGDPGWYKVSMSVRPHFKYMGASFDLSLVGKLD
QN
 
Nucleotide Sequence: 1479 bp     [Download]
>gi|197336667|ref|NC_011186.1|:c908053-906575 Vibrio fischeri MJ11 chromosome II, complete sequence
ATGACAGCAGAAGCACAAGCTCCAGAGCAAGAAGCAGCAATCGTTGAGTCTGGTTCATTACTAGATAGTA
TTCTTAATGAAACTCGTTTAAAACCAAGTGATGAAGGTTTTGATGTTGCTAAGCGCGGCGTAGAAGCGTT
CATTGGTGAGTTACTAAGTACAAATACATCAGATAAAGTCGACCAGTCGCTAGTTGATTTAATGATTTCT
GAAATTGATCAGAAATTATCAAAGCAAGTTGATGCAATTTTACATAATGAAGAAGTTCAAGCAATTGAAT
CAACTTGGCGTGGCCTAAAGTACTTGGTCGATCATACTGATTTCCGTGAAAATATTCAGATTGAATTGAT
TTCAGCGAAAAAAGATGAAGTCTTAGATGATTTTGAAGATGCTCCAGAAGTAGTTAAATCTGGCCTTTAT
AAGCAAATTTATACTCGTGAATACGGTCAATTTGGTGGTAAACCTGTTGGTGCAGTTATTTGTGACTTCC
AAATGTCAGCATCATCTCCTGATATTAAACTAATGGAATACATGGCTAACGTTGGTGCAATGTCACATGC
CCCATTTATTACGTCAGCGTCGGCTAAATTCTTCGGACTAGACAGTTATGAAGAATTACCAAACTTAAAA
GATCTTAAGTCTGTATTTGAAGGCCCACAATACACGAAATGGCGTGGATTCCGTGAACATGAAGATGCAC
GTTATGTTGGTCTTTGTACTTCTCGTATGATGCTTCGTACTCCTTACTCAGTAGAAGATAATCCAATCAA
AGCATTTGATTATAATGAACACGTAAAAGATGGTCATGATAACTATTTATGGGGTAATTCAGCTTACGCA
ATGGCATCTAAGATCAGTGAATCTTTTGCTAAGTATCGTTGGTGTCCAAACATCATTGGTCCACAAAGTG
GCGGTACCGTATCTGATCTTCCAGTATATAACTACGAGTCAATGGGACAAATTGAAACTAAGATCCCAAC
AGAGATCTTAATTTCAGACCGTCGTGAATACGAGCTAGCAGAAGAGGGTTTTATTGCGCTTACTATGCGT
AAAGGTTCTGATAATGCAGCATTCTTCTCTGCAAACTCGGTACAAAAAGCAAAAGTATTCCCGAATACGC
CAGAAGGTCAGCAAGCTGAAATGAACTATAAATTAGGTATTCAATTACCTTACATGTTCATTATTAACCG
TTTAGCACACTACATTAAAGTGCTTCAACGTGAACAGATTGGTTCATGGAAAGAACGTTCTGATTTAGAA
ATCGAGCTAAACAAATGGATCCGTCAATACGTTTCTGATCAAGAGAATCCGCCAGCAGAAGTACGTGGTC
GTCGACCTCTACGTGCTGCAAAAGTGGAAGTATCTGAAGTTGAAGGCGATCCAGGTTGGTACAAAGTATC
AATGTCAGTTCGTCCACACTTTAAGTACATGGGGGCGAGTTTTGATTTATCTCTAGTTGGAAAATTGGAT
CAAAACTAA