SecReT6
Protein ID: 197363515
SecReT6 ID297
T6SS typei3
Gene symbol-
Locus tagSSPA2307
StrainSalmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601
Repliconchromosome [GenBank: NC_011147] [Browse all T6SS(s) in this replicon]
Location [Strand]2569899..2572145 [-]
Producthypothetical protein
NoteTssI
UniProt IDB5BDT5
KEGG IDsek:SSPA2307
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.20E-80, Aligned region: 125..433
Phage_GPD [PF05954], Evalue: 5.20E-80, Aligned region: 637..651
Phage_base_V [PF04717], Evalue: 9.60E-26, Aligned region: 471..563
Protein Sequence: 748 a.a.     [Download]
>gi|197363515|ref|YP_002143152.1| hypothetical protein SSPA2307 [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
MSFVSTGNKTVGSDRPAITTPPIVGENKGVSSDAVVASVTDAAEQMAEQAVESLFGDLPEPSGLVKAAVA
AAQATAVAAGISDIAGAAQDVMSSLISGPGVHNVTVSGSAVPPQMLLFASLNGSEALGTLFTYVVQLKTP
DTLNLGYVSPAANLPLKPMVGKDLCVNIELDGGGKRHISGLVTAARVVGHEGRSVTYELRMEPWLKLLTH
TSDYKAFQNKTVVDILDEVLAEYPYPVEKRLVESYPVRTWQVQYGETDFDFLQRLMQEWGIYWWFEHSED
SHTLVLADAISAHKACPDSPLVEWHQEGLKLDKEFIHTITANESLRTGQWVLDDFDFTKPRSLLANTVAN
PRETGHATYEHYEWPGDYFDKSEGEMLTRIRMEAQRSPGSRVLGGGNIRTLMTGYTFTLENYPTAEVNQE
YLLMQTLLFVQDNAQHSGQNQHFTFSTRFELHPTREVYRPQRTISKPHTKGPQSAIVTGPAGQEIWTDQY
GRVKVQFGWDRYGKMDENSSCWIRVSYPWAGKGFGMIQIPRIGQEVLVDFKNGDPDLPIIVGRTYNQDTM
PPWGLPGAATQSGIYSHTIGGGPTNANALRFEDKPGSEEVWLHAEKDQRIEVNNNESHWVGNNRVKVIDQ
SEIATIGAVRDHKVQYDDTSLAGGNKTIQTVKELYLAAGDSITLSCGDTVLYMSSKGEFYVTCKTFNITA
TDADGQINTIKGQLDLNMDKREPKVGTFGESEKTAMAAVIKETFPPKE
 
Nucleotide Sequence: 2247 bp     [Download]
>gi|197361212|ref|NC_011147.1|:c2572145-2569899 Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601 chromosome, complete genome
ATGAGTTTTGTATCCACGGGTAATAAAACTGTCGGGAGCGATCGGCCAGCTATCACTACGCCGCCAATTG
TCGGAGAAAATAAGGGTGTTAGTTCAGATGCCGTCGTAGCCAGTGTTACTGACGCAGCCGAACAAATGGC
AGAACAGGCAGTGGAATCGTTGTTTGGCGACTTACCGGAACCATCAGGACTGGTAAAAGCAGCAGTGGCA
GCAGCGCAGGCTACCGCTGTGGCGGCAGGGATATCGGATATAGCTGGTGCCGCACAGGACGTAATGTCAT
CCCTTATCTCCGGACCGGGAGTGCATAACGTTACGGTAAGCGGCAGTGCCGTGCCGCCGCAGATGTTGTT
GTTTGCCAGCCTTAATGGCTCGGAAGCACTGGGAACCTTGTTTACTTATGTGGTACAGCTAAAAACGCCC
GACACCCTGAATCTGGGCTATGTCTCCCCGGCGGCCAACCTGCCGCTCAAACCGATGGTGGGCAAAGATC
TGTGCGTCAACATCGAACTGGATGGTGGCGGTAAACGACATATCAGCGGGCTGGTCACGGCGGCGCGGGT
GGTGGGCCATGAAGGGCGTTCGGTTACCTATGAGCTGCGTATGGAGCCGTGGCTGAAACTGCTGACCCAT
ACCAGCGACTACAAAGCATTCCAGAATAAAACCGTGGTGGATATTCTGGATGAGGTTCTGGCGGAATATC
CCTACCCGGTGGAAAAGCGGCTGGTGGAAAGCTACCCGGTACGCACCTGGCAGGTGCAGTACGGTGAAAC
TGATTTTGATTTTCTTCAGCGACTGATGCAGGAGTGGGGCATCTACTGGTGGTTTGAGCACAGCGAGGAC
AGCCACACGCTGGTGCTGGCGGATGCCATCAGCGCCCACAAAGCATGTCCGGACTCGCCGCTGGTCGAGT
GGCACCAGGAAGGGCTGAAGCTGGACAAGGAGTTTATCCACACTATCACGGCAAACGAGAGTCTGCGGAC
TGGCCAGTGGGTGCTGGATGATTTCGATTTTACGAAGCCACGTTCATTGCTGGCAAACACCGTGGCAAAC
CCGCGTGAAACCGGTCATGCCACCTACGAGCATTATGAGTGGCCGGGAGACTACTTCGACAAGAGTGAAG
GCGAGATGCTGACGCGCATTCGTATGGAAGCGCAGCGCAGCCCCGGCAGTCGGGTGCTGGGGGGAGGGAA
TATCCGCACACTCATGACCGGTTATACCTTCACGCTGGAAAACTATCCCACTGCCGAAGTCAATCAGGAA
TACCTGCTGATGCAGACCTTGCTGTTTGTGCAGGACAACGCGCAGCACAGCGGGCAGAACCAGCACTTTA
CCTTTTCCACCCGTTTTGAACTGCACCCCACCCGCGAGGTGTACCGCCCGCAGCGAACCATCAGCAAACC
CCACACCAAAGGGCCGCAGAGCGCCATCGTCACCGGCCCGGCGGGCCAGGAAATCTGGACGGATCAGTAC
GGGCGGGTAAAGGTACAGTTTGGCTGGGATCGCTACGGCAAAATGGATGAAAACAGCTCCTGCTGGATAC
GCGTCAGCTACCCGTGGGCGGGCAAAGGCTTCGGGATGATCCAGATCCCGCGTATCGGCCAGGAAGTGCT
GGTGGATTTCAAAAACGGCGATCCGGATCTGCCGATCATCGTGGGGCGTACCTACAACCAGGACACCATG
CCGCCGTGGGGACTGCCGGGCGCGGCAACACAGAGCGGGATATACAGCCACACTATCGGCGGCGGACCGA
CCAATGCCAACGCCCTGCGTTTTGAAGATAAACCCGGTAGTGAAGAGGTCTGGCTACATGCTGAAAAAGA
TCAGCGTATTGAAGTTAATAATAATGAAAGTCACTGGGTGGGGAATAATCGGGTTAAGGTCATTGATCAG
TCAGAAATAGCCACTATTGGTGCTGTCCGCGACCATAAAGTTCAGTATGACGATACCTCTCTGGCCGGAG
GAAATAAAACCATTCAGACGGTAAAAGAGTTATATCTGGCAGCGGGTGATTCTATTACTCTGAGTTGTGG
TGACACCGTTCTGTACATGAGCAGTAAGGGGGAATTTTACGTAACCTGTAAAACGTTCAATATTACTGCA
ACAGATGCCGATGGTCAGATTAATACTATAAAAGGGCAGCTGGATTTAAATATGGATAAAAGAGAACCCA
AAGTGGGAACATTTGGTGAGTCAGAAAAAACAGCAATGGCAGCAGTAATTAAGGAAACTTTCCCACCCAA
AGAATAG