SecReT6
Protein ID: 197363526
SecReT6 ID297
T6SS typei3
Gene symbol-
Locus tagSSPA2318
StrainSalmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601
Repliconchromosome [GenBank: NC_011147] [Browse all T6SS(s) in this replicon]
Location [Strand]2582831..2584174 [-]
Producthypothetical protein
NoteTssK
UniProt IDB5BDU6
KEGG IDsek:SSPA2318
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 8.10E-138, Aligned region: 20..445
Protein Sequence: 447 a.a.     [Download]
>gi|197363526|ref|YP_002143163.1| hypothetical protein SSPA2318 [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
MSWNDRVVWSEGQFLLPQMFQQQERYLEHVMHYRSLPLTPFFWGFSHYNIDGEALNIGKLILKEASGIFP
DGTPFNAPDHTPLPPPLTILPEHLNQQICLAVPVRAPNSEETTFDNNPESLARFSVHEHDIRDANSLGRG
AQLLQLSHLRLRLLPEKAVTGAWIGLPLTRITGLNPDGRIDIDHDLIPPIINYQASSLMCTWLSWINDLI
RMRADSLAERLTGSDNHGHEAAEVSDYLLLQILNRFEPLLTHLAKTPLAPEVLYRYLSELAGELSTYVRP
QTRRPAEYKEYKHLTPYAGLKSLVDEVQFLLNAVLIRGAQRIELKEGTYGILNAVVAPSDLADFSTLVLA
IKASMPTDVLLQHFAAQTKIGPSDRLPELIRSHLPGLALQVLPVPPRQIPFQAGYIYYDIRREGALWEHI
ARYGGMAMHTAGEFPGLETELWGVRDK
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|197361212|ref|NC_011147.1|:c2584174-2582831 Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601 chromosome, complete genome
ATGAGCTGGAATGACCGCGTAGTCTGGAGTGAAGGACAATTTTTACTGCCGCAGATGTTTCAGCAGCAAG
AGCGTTATCTGGAACATGTCATGCATTACCGTAGCCTGCCGCTGACCCCCTTTTTCTGGGGATTCAGCCA
CTACAATATTGATGGCGAAGCGCTGAACATCGGTAAACTGATACTGAAAGAGGCATCAGGGATTTTTCCT
GACGGCACGCCGTTTAACGCACCGGACCACACCCCGCTGCCGCCGCCGCTGACCATCCTGCCGGAGCACC
TGAACCAGCAGATTTGTCTGGCGGTACCGGTACGCGCGCCGAACAGCGAAGAAACTACGTTTGACAATAA
CCCGGAATCACTGGCGCGTTTCTCGGTACATGAACACGACATCCGCGACGCCAACTCGCTGGGACGTGGC
GCGCAGTTATTACAGCTCAGTCACCTGCGCCTGCGGCTGCTGCCGGAAAAAGCGGTGACGGGCGCCTGGA
TTGGCCTGCCGCTGACCCGCATCACCGGGCTAAACCCTGACGGGCGGATAGATATCGACCACGACCTGAT
CCCGCCCATCATTAATTATCAGGCCAGTTCGCTGATGTGTACCTGGCTGTCGTGGATCAACGATCTCATC
CGAATGCGGGCCGATTCGCTGGCGGAACGGCTGACAGGCAGCGACAACCACGGCCATGAAGCAGCGGAGG
TCTCCGATTACCTGCTGCTGCAAATTCTCAATCGCTTTGAGCCGCTGCTGACTCACCTGGCGAAAACCCC
GCTGGCCCCGGAAGTGTTGTATCGCTACCTGTCCGAACTGGCCGGGGAACTCTCCACGTATGTGCGTCCA
CAAACGCGACGGCCCGCTGAATACAAAGAGTACAAACACCTGACGCCCTATGCCGGGTTGAAATCACTGG
TTGATGAGGTGCAGTTCCTGCTGAATGCGGTACTGATCCGGGGCGCGCAGCGCATCGAACTGAAAGAGGG
GACTTACGGCATCCTGAATGCGGTGGTGGCTCCTTCCGATCTTGCCGATTTCAGCACGCTGGTACTGGCG
ATAAAGGCTTCAATGCCGACCGATGTGCTACTGCAACATTTTGCCGCCCAGACCAAAATCGGGCCATCCG
ATCGCCTGCCGGAACTGATCCGCTCGCATCTGCCGGGGCTGGCTTTGCAGGTTCTGCCTGTACCACCGCG
CCAAATCCCGTTTCAGGCCGGATACATCTATTACGACATCCGCCGCGAGGGAGCATTGTGGGAACACATT
GCCCGTTACGGCGGGATGGCCATGCATACCGCCGGGGAATTTCCGGGGCTGGAGACAGAACTGTGGGGAG
TGCGCGATAAATGA