SecReT6
Protein ID: 197363528
SecReT6 ID297
T6SS typei3
Gene symbol-
Locus tagSSPA2320
StrainSalmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601
Repliconchromosome [GenBank: NC_011147] [Browse all T6SS(s) in this replicon]
Location [Strand]2584782..2585267 [-]
Producthypothetical protein
NoteTssD
UniProt IDB5BDU8
KEGG IDsek:SSPA2320
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.70E-40, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|197363528|ref|YP_002143165.1| hypothetical protein SSPA2320 [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
MSYDIFLKIDGIDGESMGDKHKNEIEVLSWRWNIHQESTMHAGSGLGSGKVSVTNLSFEHYIDRASPNLF
KYCSSGKHIPQAIPVMRKAGGNPLEYLKYTFTDLIIAMVSPSGSQGGEIASRESIELSFSTVKQEYVVQN
QQGGSGGTITAGYDFKANKEI
 
Nucleotide Sequence: 486 bp     [Download]
>gi|197361212|ref|NC_011147.1|:c2585267-2584782 Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601 chromosome, complete genome
ATGTCTTATGACATTTTTCTGAAAATTGACGGCATCGACGGCGAGTCAATGGGTGACAAACACAAAAATG
AAATTGAAGTACTGAGCTGGCGCTGGAATATTCATCAGGAATCCACCATGCACGCCGGTAGCGGTCTCGG
TTCCGGTAAGGTCTCCGTCACTAATCTTTCATTTGAACATTACATCGATCGCGCCAGCCCGAACCTGTTC
AAATACTGCTCTTCCGGTAAGCACATTCCGCAGGCCATTCCGGTTATGCGTAAGGCTGGCGGCAATCCGC
TGGAGTACCTCAAGTACACTTTCACAGATCTGATTATTGCAATGGTATCGCCCAGCGGAAGCCAGGGAGG
GGAAATTGCGTCTCGCGAATCAATTGAACTCTCCTTCAGCACCGTGAAGCAGGAATACGTGGTGCAGAAC
CAGCAGGGTGGCAGCGGCGGCACCATCACCGCAGGCTACGACTTCAAGGCCAACAAAGAAATTTAA