SecReT6
Protein ID: 197363529
SecReT6 ID297
T6SS typei3
Gene symbol-
Locus tagSSPA2321
StrainSalmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601
Repliconchromosome [GenBank: NC_011147] [Browse all T6SS(s) in this replicon]
Location [Strand]2585410..2585793 [-]
Productperiplasmic protein
NoteSTM0278 (i)
UniProt IDB5BDU9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 127 a.a.     [Download]
>gi|197363529|ref|YP_002143166.1| periplasmic protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
MDTAVKWLILVTFSISGMLVWQPSFAQEALTTQYSQSELLKNWALSHCLALVYKDDVVKNDARATASAYL
EYGKQSVEIYHEIDEIAKKYSGLKYNGSISSDFNTMKCIDFIHDRELNELIKRRVEK
 
Nucleotide Sequence: 384 bp     [Download]
>gi|197361212|ref|NC_011147.1|:c2585793-2585410 Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601 chromosome, complete genome
GTGGATACTGCCGTGAAATGGTTAATATTAGTTACTTTCAGCATAAGTGGAATGCTGGTATGGCAGCCAT
CCTTTGCACAAGAAGCATTGACCACACAATATTCACAGTCGGAACTCTTAAAAAACTGGGCGCTGAGTCA
TTGTCTGGCATTAGTATACAAAGATGATGTCGTTAAAAACGATGCCAGAGCTACGGCCAGTGCTTACCTT
GAATATGGTAAACAATCTGTGGAGATTTACCATGAAATTGATGAGATTGCGAAAAAATATTCAGGGTTGA
AATATAACGGCTCGATATCATCAGATTTTAATACCATGAAGTGCATAGATTTTATCCACGACAGGGAATT
AAATGAATTAATTAAAAGGCGTGTCGAGAAGTAA