SecReT6
Protein ID: 197363532
SecReT6 ID297
T6SS typei3
Gene symbol-
Locus tagSSPA2324
StrainSalmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601
Repliconchromosome [GenBank: NC_011147] [Browse all T6SS(s) in this replicon]
Location [Strand]2586557..2587042 [-]
Producthypothetical protein
NoteTssD
UniProt IDB5BDV2
KEGG IDsek:SSPA2324
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.10E-40, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|197363532|ref|YP_002143169.1| hypothetical protein SSPA2324 [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
MAYDIFLKIDGIDGESMDDKHKNEIEVLGWRWNIHQESTMHAGSGLGSGKVSVTNLEFEHYIDRASPNLF
KYCASGKHIPQAILVMRKAGGNPLEYLKYTFTDLIVAVVSPSGNREGEIASRERIELSFSTVKQEYVVQN
QQGGSGGTITAGYDFKANKEI
 
Nucleotide Sequence: 486 bp     [Download]
>gi|197361212|ref|NC_011147.1|:c2587042-2586557 Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601 chromosome, complete genome
ATGGCTTATGACATTTTTTTGAAAATTGACGGCATTGACGGCGAGTCAATGGATGACAAACACAAAAATG
AAATTGAAGTACTGGGCTGGCGCTGGAATATTCATCAGGAATCCACCATGCACGCCGGTAGTGGCCTCGG
CTCCGGTAAGGTCTCTGTCACTAATCTGGAATTCGAGCATTATATCGATCGCGCCAGCCCGAATCTGTTC
AAATACTGTGCCTCCGGTAAGCACATTCCGCAGGCCATTCTGGTTATGCGTAAGGCTGGCGGCAACCCGT
TGGAGTACCTCAAGTACACCTTTACCGATCTGATCGTTGCGGTCGTTTCACCTAGCGGTAACAGAGAAGG
CGAAATCGCGTCTCGCGAGCGGATTGAGCTCTCCTTCAGCACCGTGAAGCAGGAATACGTGGTGCAGAAC
CAGCAGGGTGGCAGCGGCGGCACCATCACCGCAGGCTACGACTTCAAGGCCAACAAAGAAATTTAA