SecReT6
Protein ID: 197363535
SecReT6 ID297
T6SS typei3
Gene symbol-
Locus tagSSPA2327
StrainSalmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601
Repliconchromosome [GenBank: NC_011147] [Browse all T6SS(s) in this replicon]
Location [Strand]2589738..2590280 [-]
Producthypothetical protein
NoteTssB
UniProt IDB5BDV5
KEGG IDsek:SSPA2327
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.50E-58, Aligned region: 11..164
Protein Sequence: 180 a.a.     [Download]
>gi|197363535|ref|YP_002143172.1| hypothetical protein SSPA2327 [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
MAINNSAQKFIARNRAPCVQIEYDVEIYGSEKKIELPFVMAVLADLAGKPREELPPVTDRKFLDIDIDNF
NERMKAIAPRVAFAVPNTLTGEGQLMVDITLENMDDFSPAQIARKVDALNQLLEARTQLANLQTYMDGKA
GAENLVNKLLQDPTLLKTLANAPKSAATQQDVSADNESAE
 
Nucleotide Sequence: 543 bp     [Download]
>gi|197361212|ref|NC_011147.1|:c2590280-2589738 Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601 chromosome, complete genome
ATGGCTATCAACAATAGTGCGCAGAAATTCATCGCGCGCAACCGCGCGCCGTGCGTGCAGATTGAATATG
ACGTAGAGATTTACGGCTCTGAGAAAAAAATCGAGCTGCCGTTCGTGATGGCGGTGCTGGCCGATCTGGC
CGGGAAACCGCGTGAAGAACTGCCGCCGGTGACGGATCGCAAATTCCTCGATATTGATATTGATAACTTC
AATGAGCGTATGAAAGCCATTGCGCCGCGCGTGGCGTTCGCCGTGCCGAATACGCTGACGGGTGAAGGTC
AGTTGATGGTCGATATCACGCTGGAAAATATGGACGACTTTTCGCCGGCACAGATTGCCCGCAAGGTGGA
CGCCCTGAACCAGTTACTGGAAGCCCGCACTCAACTGGCGAACCTCCAGACCTACATGGATGGCAAGGCG
GGGGCGGAAAATCTGGTCAATAAACTGTTGCAGGACCCGACTCTGCTGAAAACGCTGGCGAATGCGCCGA
AATCGGCCGCTACCCAGCAAGATGTGTCAGCGGATAATGAATCAGCGGAATAA