SecReT6
Protein ID: 197363538
SecReT6 ID297
T6SS typei3
Gene symbol-
Locus tagSSPA2330
StrainSalmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601
Repliconchromosome [GenBank: NC_011147] [Browse all T6SS(s) in this replicon]
Location [Strand]2590718..2593381 [-]
ProductClpB-like protein
NoteTssH
UniProt IDB5BDV8
KEGG IDsek:SSPA2330
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 6.10E-40, Aligned region: 235..313
AAA_2 [PF07724], Evalue: 6.10E-40, Aligned region: 609..776
AAA [PF00004], Evalue: 3.30E-19, Aligned region: 236..368
AAA [PF00004], Evalue: 3.30E-19, Aligned region: 381..402
AAA [PF00004], Evalue: 3.30E-19, Aligned region: 615..699
AAA_5 [PF07728], Evalue: 2.20E-12, Aligned region: 236..313
AAA_5 [PF07728], Evalue: 2.20E-12, Aligned region: 614..732
ClpB_D2-small [PF10431], Evalue: 4.80E-12, Aligned region: 785..856
AAA_16 [PF13191], Evalue: 7.40E-11, Aligned region: 213..258
AAA_16 [PF13191], Evalue: 7.40E-11, Aligned region: 470..532
AAA_16 [PF13191], Evalue: 7.40E-11, Aligned region: 605..659
AAA_16 [PF13191], Evalue: 7.40E-11, Aligned region: 678..708
AAA_22 [PF13401], Evalue: 1.40E-07, Aligned region: 236..402
AAA_22 [PF13401], Evalue: 1.40E-07, Aligned region: 613..634
AAA_22 [PF13401], Evalue: 1.40E-07, Aligned region: 676..706
Sigma54_activat [PF00158], Evalue: 4.40E-06, Aligned region: 232..252
Sigma54_activat [PF00158], Evalue: 4.40E-06, Aligned region: 614..714
IstB_IS21 [PF01695], Evalue: 2.30E-05, Aligned region: 220..295
IstB_IS21 [PF01695], Evalue: 2.30E-05, Aligned region: 614..634
AAA_25 [PF13481], Evalue: 3.20E-05, Aligned region: 236..335
AAA_25 [PF13481], Evalue: 3.20E-05, Aligned region: 473..531
AAA_25 [PF13481], Evalue: 3.20E-05, Aligned region: 609..642
AAA_25 [PF13481], Evalue: 3.20E-05, Aligned region: 676..697
NACHT [PF05729], Evalue: 5.80E-05, Aligned region: 236..263
NACHT [PF05729], Evalue: 5.80E-05, Aligned region: 614..642
AAA_19 [PF13245], Evalue: 8.30E-05, Aligned region: 234..259
AAA_19 [PF13245], Evalue: 8.30E-05, Aligned region: 386..413
AAA_19 [PF13245], Evalue: 8.30E-05, Aligned region: 430..456
AAA_19 [PF13245], Evalue: 8.30E-05, Aligned region: 612..636
Zeta_toxin [PF06414], Evalue: 9.70E-05, Aligned region: 236..256
Zeta_toxin [PF06414], Evalue: 9.70E-05, Aligned region: 318..404
Zeta_toxin [PF06414], Evalue: 9.70E-05, Aligned region: 608..664
AAA_29 [PF13555], Evalue: 0.00038, Aligned region: 226..253
AAA_29 [PF13555], Evalue: 0.00038, Aligned region: 612..638
AAA_14 [PF13173], Evalue: 0.00055, Aligned region: 236..316
AAA_14 [PF13173], Evalue: 0.00055, Aligned region: 382..403
AAA_14 [PF13173], Evalue: 0.00055, Aligned region: 613..696
AAA_14 [PF13173], Evalue: 0.00055, Aligned region: 778..800
AAA_17 [PF13207], Evalue: 0.0034, Aligned region: 237..248
AAA_17 [PF13207], Evalue: 0.0034, Aligned region: 614..650
RNA_helicase [PF00910], Evalue: 0.0058, Aligned region: 189..210
RNA_helicase [PF00910], Evalue: 0.0058, Aligned region: 237..257
RNA_helicase [PF00910], Evalue: 0.0058, Aligned region: 615..636
AAA_18 [PF13238], Evalue: 0.0069, Aligned region: 236..249
AAA_18 [PF13238], Evalue: 0.0069, Aligned region: 616..639
Arch_ATPase [PF01637], Evalue: 0.0076, Aligned region: 215..251
Arch_ATPase [PF01637], Evalue: 0.0076, Aligned region: 290..318
Arch_ATPase [PF01637], Evalue: 0.0076, Aligned region: 381..409
Arch_ATPase [PF01637], Evalue: 0.0076, Aligned region: 613..627
AAA_30 [PF13604], Evalue: 0.0082, Aligned region: 235..272
AAA_30 [PF13604], Evalue: 0.0082, Aligned region: 613..643
AAA_30 [PF13604], Evalue: 0.0082, Aligned region: 671..697
Protein Sequence: 887 a.a.     [Download]
>gi|197363538|ref|YP_002143175.1| ClpB-like protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
METPVSRSALYGKLAGPLFRSLESATAFCKLRSNPWVELTHWLHQLTQQPDNDILHVLRHYQIPLSDVEK
VLLRQLDMLPAGASAISDFSHHIDLSVEKAWMLASVRYGDNKIRSGWLLLALLTTPELRRVLSSICAPLA
TLPVDELTEILPSLIETSPEAQERPYDGSGLASAIPGENSQAIPNGGQDGKSALAKYCQDMTAQARDGKI
DPVTGREHEIRTMTDILLRRRQNNPLLTGEAGVGKTAVVEGFALAIAQGEVPPALREVRLLALDVGALLA
GASMKGEFESRLKGLLEEAGRSPQPVILFVDEVHTLVGAGGASGTGDAANLLKPALARGTLRTIGATTWS
EYKRHIEKDPALTRRFQVLQIAEPEEIPAMEMVRGLVDTLEKHHNVLILDEAVRAAVQLSHRYIPARQLP
DKAISLLDTAAARVALTLHTPPASVQFLRQQLKAAEMERSLLQKQEKMGIQSDERRDALTARIFSLNDEL
TASESRWQRELELVHTLQELRLVEPDADDKTTLQQAETALREWQGDAPVVFPEVSAAVVAAIVADWTGIP
AGRMVKDEASQVLELPARLAQRVTGQDGALAQIGERIQTARAGLGDPRKPVGVFMLAGPSGVGKTETALA
LAEAIYGGEQNLITINMSEFQEAHTVSTLKGAPPGYVGYGEGGVLTEAVRRHPWSVVLLDEIEKAHHDVH
ELFYQVFDKGGMEDGEGTHVDFKNTTLLLTTNVGSDLISQMCEDPALMPDATGLKEALMPELRKHFPAAF
LGRVTVIPYLLLDETSRGVIARLHLDRLVTRMGEQHGVTLMYSEELVAHIVACCPMHETGARLLISYIEQ
HILPRLSRYWLQAMTEKAAIRQIDIGVNGDEQIVFETTSQEGICQKS
 
Nucleotide Sequence: 2664 bp     [Download]
>gi|197361212|ref|NC_011147.1|:c2593381-2590718 Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601 chromosome, complete genome
ATGGAAACTCCTGTTTCACGCAGTGCGTTGTATGGAAAACTGGCCGGCCCACTATTCCGGTCGCTGGAAT
CGGCAACGGCATTTTGCAAACTACGCTCTAATCCCTGGGTTGAGCTGACTCACTGGCTGCACCAGTTAAC
ACAGCAGCCCGATAACGATATTCTCCACGTTCTTCGGCATTACCAAATCCCTCTTTCTGATGTGGAGAAA
GTGTTACTCCGGCAACTGGATATGCTGCCCGCCGGGGCCAGCGCCATCAGTGATTTTTCTCACCATATCG
ATCTCAGCGTTGAAAAGGCATGGATGCTGGCGAGCGTCCGTTACGGCGATAACAAAATTCGCAGTGGCTG
GTTGCTGCTGGCCTTGTTGACCACGCCAGAACTGCGTCGGGTACTGAGCAGTATCTGCGCGCCGCTGGCC
ACGCTTCCGGTTGATGAACTGACGGAAATACTGCCCTCGTTGATCGAAACATCGCCGGAAGCGCAGGAGC
GTCCTTACGACGGCTCCGGCCTGGCATCAGCCATTCCCGGCGAAAACAGTCAGGCGATTCCCAACGGCGG
GCAGGACGGTAAATCCGCGCTGGCGAAATACTGTCAGGACATGACGGCACAGGCGCGCGACGGCAAAATC
GACCCGGTGACGGGGCGTGAGCATGAAATCCGCACCATGACGGATATTCTGCTGCGCCGTCGCCAGAATA
ATCCCCTACTGACTGGTGAGGCGGGCGTCGGAAAGACGGCGGTCGTCGAAGGTTTTGCCCTCGCGATTGC
GCAGGGGGAAGTGCCGCCCGCGCTGCGGGAAGTACGGCTACTGGCGCTGGACGTTGGCGCTCTGTTGGCC
GGAGCCAGCATGAAAGGCGAGTTTGAATCGCGTCTGAAAGGGTTACTGGAAGAGGCCGGGCGCTCGCCGC
AGCCGGTTATTCTGTTTGTCGATGAAGTCCACACTCTGGTGGGCGCGGGCGGCGCATCCGGCACGGGCGA
TGCCGCTAACCTGCTGAAACCGGCGCTGGCGCGCGGCACCCTGCGGACTATCGGCGCCACCACCTGGAGC
GAATACAAGCGCCATATTGAGAAAGATCCGGCGCTGACCCGTCGTTTTCAGGTGTTGCAGATTGCCGAAC
CGGAAGAGATCCCCGCAATGGAAATGGTGCGTGGTCTGGTGGATACGCTGGAAAAACACCATAACGTACT
GATTCTGGATGAGGCGGTACGTGCGGCGGTACAGCTTTCTCACCGCTACATTCCCGCCCGGCAGTTGCCG
GATAAGGCTATCAGCCTGCTGGATACCGCCGCGGCCCGCGTGGCGCTGACGCTGCACACGCCGCCTGCCA
GCGTACAGTTCCTGCGCCAGCAGCTAAAAGCGGCGGAAATGGAACGGTCGCTGTTGCAGAAGCAGGAAAA
AATGGGGATTCAGTCAGATGAGCGGCGCGATGCGCTGACGGCGCGAATTTTCTCGCTCAACGATGAACTG
ACTGCATCCGAATCCCGCTGGCAGCGGGAGCTGGAACTGGTACATACGTTGCAGGAACTGCGTCTCGTAG
AGCCAGATGCTGATGACAAAACCACGCTGCAACAGGCCGAAACGGCGCTAAGGGAGTGGCAGGGTGACGC
GCCGGTGGTGTTCCCGGAAGTCAGCGCGGCGGTGGTCGCGGCGATTGTCGCCGACTGGACCGGTATTCCT
GCCGGGCGCATGGTGAAAGATGAGGCCAGCCAGGTGCTGGAACTGCCTGCCCGACTGGCGCAACGCGTTA
CCGGGCAAGACGGCGCGCTGGCGCAGATTGGTGAACGTATTCAGACCGCCAGGGCGGGACTGGGCGATCC
ACGCAAACCGGTGGGCGTGTTTATGCTGGCCGGGCCGTCCGGTGTCGGTAAAACCGAAACCGCGCTGGCG
CTGGCGGAGGCTATCTACGGCGGTGAGCAGAACCTGATTACCATCAATATGAGCGAGTTCCAGGAGGCTC
ACACCGTTTCCACGCTGAAAGGCGCGCCCCCCGGCTATGTGGGCTATGGCGAGGGTGGTGTGCTGACGGA
AGCGGTGCGTCGCCACCCCTGGAGCGTAGTGCTGCTCGACGAGATCGAAAAAGCGCACCATGACGTCCAT
GAACTCTTCTATCAGGTGTTTGACAAGGGCGGGATGGAGGACGGTGAGGGAACACATGTCGATTTCAAAA
ACACCACGCTATTACTCACCACCAACGTGGGTTCCGACCTCATCAGCCAGATGTGTGAAGATCCGGCCTT
AATGCCCGATGCTACGGGGCTTAAAGAGGCGCTAATGCCGGAATTGCGCAAGCATTTCCCGGCGGCATTT
CTGGGCCGCGTGACGGTGATCCCTTACCTGCTGCTGGATGAAACGTCGCGTGGCGTGATTGCCCGTCTGC
ATCTTGACCGGCTGGTGACGCGGATGGGTGAACAGCACGGCGTGACGCTGATGTATAGCGAGGAACTGGT
CGCACATATTGTGGCGTGTTGCCCAATGCATGAAACGGGCGCGCGGTTGCTGATTAGCTACATCGAACAG
CACATTCTGCCACGACTGTCGCGCTACTGGTTGCAGGCCATGACGGAAAAAGCTGCTATCAGGCAGATTG
ATATCGGCGTTAATGGTGATGAGCAGATTGTTTTTGAGACAACCTCGCAGGAGGGAATATGCCAAAAGAG
TTAA