SecReT6
Protein ID: 197363539
SecReT6 ID297
T6SS typei3
Gene symbol-
Locus tagSSPA2331
StrainSalmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601
Repliconchromosome [GenBank: NC_011147] [Browse all T6SS(s) in this replicon]
Location [Strand]2594638..2595462 [+]
Producthypothetical protein
NoteTagJ
UniProt IDB5BDV9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 9.10E-46, Aligned region: 143..266
Protein Sequence: 274 a.a.     [Download]
>gi|197363539|ref|YP_002143176.1| hypothetical protein SSPA2331 [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
MKKTDTLPATLSALLQEYSIAEGIQMAEQQVRENPAKALCRHSLFQLLCVAGDWSRALHQLQLCTRMEAN
YTQEARLYRELVRCEMFRHTVFQGEQRPGFLLPQPVWVESLLAALACHDDTGEVDKHRNTALEAITDTGG
QWNGGAFDWASDSDSRLGPVLELVTGGVYIWLPFSQIRSLESPQPTRLTDLLWKPVNITLVNGDTHGAWL
FTRYSGSESASDALRLCRETAWQDGPGETTVRALGQKVWLTSHGDISLLDMAHCTFHAQENDGA
 
Nucleotide Sequence: 825 bp     [Download]
>gi|197361212|ref|NC_011147.1|:2594638-2595462 Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601 chromosome, complete genome
ATGAAAAAAACTGACACGCTTCCTGCTACCCTGTCCGCGCTGCTACAGGAATACTCTATTGCGGAGGGGA
TTCAGATGGCGGAGCAGCAGGTTCGGGAAAATCCGGCGAAGGCGCTCTGCCGCCATAGCCTGTTTCAGTT
GCTGTGTGTGGCCGGAGACTGGTCGCGGGCGCTGCACCAGCTTCAGCTATGCACCAGGATGGAGGCCAAT
TATACCCAGGAGGCCCGGCTGTACCGGGAGCTGGTTCGCTGCGAAATGTTCCGCCACACCGTTTTTCAGG
GTGAACAACGACCCGGTTTTCTTCTGCCGCAGCCCGTTTGGGTGGAGTCACTGCTGGCGGCACTCGCCTG
TCATGACGATACCGGCGAGGTTGATAAACACCGTAATACCGCACTGGAAGCCATAACAGATACTGGCGGA
CAGTGGAACGGCGGCGCATTTGACTGGGCGAGCGACAGCGATTCCCGCCTTGGCCCGGTACTTGAGCTGG
TCACCGGCGGCGTGTATATCTGGCTGCCGTTTTCGCAAATACGCTCGCTGGAATCGCCGCAACCGACGCG
CCTGACCGATCTGCTGTGGAAACCCGTTAATATCACCCTGGTGAATGGCGATACGCACGGTGCCTGGCTC
TTTACCCGTTACAGCGGTTCGGAAAGTGCATCTGACGCCCTGCGTCTGTGCCGGGAAACCGCCTGGCAGG
ATGGCCCCGGCGAAACCACCGTGCGGGCGCTGGGGCAGAAAGTGTGGCTGACCAGCCACGGCGATATCAG
CCTGCTGGACATGGCCCATTGTACCTTTCATGCTCAGGAAAACGATGGCGCATGA