SecReT6
Protein ID: 197363543
SecReT6 ID297
T6SS typei3
Gene symbol-
Locus tagSSPA2335
StrainSalmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601
Repliconchromosome [GenBank: NC_011147] [Browse all T6SS(s) in this replicon]
Location [Strand]2598855..2599898 [+]
Productcytoplasmic protein
NoteTssA
UniProt IDB5BDW3
KEGG IDsek:SSPA2335
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.70E-18, Aligned region: 47..106
ImpA-rel_N [PF06812], Evalue: 2.70E-18, Aligned region: 220..237
Protein Sequence: 347 a.a.     [Download]
>gi|197363543|ref|YP_002143180.1| cytoplasmic protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
MDMSLTKPVSAEQPCGPDPEYLLLFSRAAPQAEAQYGDFVSTPEAVNWPEIERDARRLLTRSKDIRVLIL
LLRSRIQQAGAQGLAEMLMQLAELSVIWSDALHPQLLTGEGASAESIEDAALARSNALAALLDHEGVMAD
IRGITLSNSAALRLQVRDVERALSAPRPADALAPESVRQQLADLEARGALPLAAFREAQESAERLQVWAR
ETLGDLAPDFSRLRQLLALLPDVVQTTTPEIPPSPAPVPDPAGTVMDNAVPARAEDVPPVNAPPGISLPH
NAEPGPIRDRNDALERLRCIRRWFESSEPSSPTIPLLCQAERLVGKRFSEVINEIPVELLEKWDALE
 
Nucleotide Sequence: 1044 bp     [Download]
>gi|197361212|ref|NC_011147.1|:2598855-2599898 Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601 chromosome, complete genome
ATGGATATGTCCCTGACTAAACCGGTAAGCGCGGAACAACCCTGCGGCCCCGATCCGGAGTACCTGCTGC
TGTTCAGCCGCGCCGCCCCCCAGGCGGAGGCGCAATATGGTGATTTTGTCAGTACGCCGGAAGCCGTGAA
CTGGCCGGAAATTGAGCGTGATGCGCGCCGTCTGCTCACGCGCAGTAAGGATATCCGGGTGTTGATCCTG
CTGCTGCGCAGTCGCATCCAGCAGGCTGGCGCACAGGGACTGGCGGAAATGCTCATGCAACTGGCAGAAC
TGAGCGTAATCTGGTCTGATGCACTCCATCCGCAGCTGCTTACCGGCGAAGGCGCATCCGCAGAGTCTAT
TGAAGATGCGGCGCTGGCGCGCAGTAATGCCCTGGCGGCGCTGCTGGATCACGAAGGCGTGATGGCAGAC
ATTCGCGGTATCACGCTGTCAAACAGTGCCGCCCTGCGCCTGCAGGTACGGGATGTCGAGCGCGCGTTAT
CCGCTCCCCGCCCGGCTGATGCGCTGGCCCCCGAATCCGTCCGCCAGCAACTGGCCGACCTCGAAGCCCG
TGGGGCATTACCGCTGGCGGCGTTTCGCGAAGCGCAGGAAAGCGCAGAACGCCTGCAAGTGTGGGCGCGT
GAGACATTAGGCGATCTGGCTCCAGATTTTTCACGCCTGCGGCAGTTGTTAGCGCTGCTGCCTGACGTGG
TACAGACAACCACACCGGAAATCCCTCCGTCGCCAGCGCCAGTGCCAGACCCCGCAGGCACGGTTATGGA
TAATGCCGTTCCGGCACGGGCAGAGGATGTGCCGCCTGTCAACGCGCCACCCGGTATATCCCTCCCACAC
AATGCTGAACCGGGGCCAATTCGCGATCGTAATGATGCGCTGGAACGCCTGCGGTGCATTCGTCGCTGGT
TTGAGAGCAGTGAACCCAGCAGCCCGACCATCCCACTGTTATGTCAGGCTGAAAGACTGGTGGGAAAACG
GTTCTCGGAGGTGATCAATGAGATCCCGGTGGAGTTGCTGGAGAAGTGGGATGCCCTGGAGTGA