SecReT6
Protein ID: 198241763
SecReT6 ID302
T6SS typei1
Gene symbol-
Locus tagSeD_A1223
StrainSalmonella enterica subsp. enterica serovar Dublin str. CT_02021853
Repliconchromosome [GenBank: NC_011205] [Browse all T6SS(s) in this replicon]
Location [Strand]1217239..1218570 [-]
Producthypothetical protein
NoteTssK
UniProt IDB5FRS0
KEGG IDsed:SeD_A1223
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 5.40E-147, Aligned region: 20..442
Protein Sequence: 443 a.a.     [Download]
>gi|198241763|ref|YP_002215075.1| hypothetical protein SeD_A1223 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
MATTRNKVMWREGTLMRPHHLQQQQRYNDYVNNLRFRAIHDLSWGFTELSLNDELLGQGKIMIDSASGTL
PDGTVFSLPDQDALPDPLHPDSFPDEESRNVYLALPVASDVRGEVSYGQQVGRYRLNDASVRDLHSENGD
ARTLTLGQLTPRIMSGADDMSAYVTLPLCRIKDRRADGSLMLDENFIPTCQNVYVSARLREFLREVQEAV
GGRANDLANRIGSPAQSGIADVAEFMMLQLLNRNQTRFTHRARRPHLHPEDFYLDLAGLLGELMTFTEPS
RLPCPLDVYDHRNLTDTFKTLLPEVKRALHTVLSPRAVNLPLHLRDGIWQADVHDSTLLQSATFVLAVAA
KMETLQLQRQFIQQSKISSPEKIRNMVSVQIPGIPLHTLMVAPRQLPYHAGFSYFELDKSGAAWADVAAT
GAVALHVSGTFPDLNMQLWAIRG
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|198241740|ref|NC_011205.1|:c1218570-1217239 Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 chromosome, complete genome
ATGGCAACCACGCGAAACAAGGTGATGTGGCGGGAAGGAACGCTGATGCGTCCGCACCATCTCCAGCAGC
AACAACGTTATAACGATTATGTGAATAATCTGCGTTTCCGGGCCATTCATGATTTGTCCTGGGGATTTAC
CGAGCTTTCCCTCAATGATGAGCTGCTGGGACAGGGCAAAATTATGATCGACAGCGCGTCGGGCACCCTG
CCGGACGGCACCGTGTTTTCCCTTCCGGACCAGGATGCGCTCCCCGATCCGCTGCATCCGGACAGTTTTC
CTGATGAAGAAAGCCGCAATGTCTATCTGGCTTTACCCGTTGCCAGCGATGTGAGAGGCGAAGTCAGTTA
CGGGCAGCAGGTTGGGCGTTACCGGCTGAACGATGCCAGTGTCCGGGATCTGCACTCCGAGAATGGCGAT
GCCCGGACGCTGACGCTGGGCCAGTTGACCCCCCGCATTATGAGCGGAGCGGACGATATGAGCGCGTATG
TCACGTTGCCGCTGTGCCGTATCAAAGACAGGCGTGCGGACGGCTCCCTGATGCTGGATGAAAACTTTAT
CCCTACCTGCCAGAACGTTTATGTCAGCGCACGGCTGCGTGAATTTCTCCGGGAAGTCCAGGAAGCGGTT
GGCGGCCGGGCCAATGACCTGGCTAACCGCATTGGCTCTCCGGCGCAAAGCGGTATTGCCGACGTTGCGG
AATTTATGATGCTGCAACTGCTCAACCGTAACCAGACGCGGTTCACCCACCGCGCCCGCAGGCCGCACCT
CCATCCGGAAGATTTTTATCTCGATCTGGCCGGACTGCTGGGCGAGCTGATGACATTTACCGAGCCATCC
CGCCTGCCCTGTCCGCTGGATGTCTACGATCACCGTAACCTGACGGACACCTTCAAAACGCTGTTGCCGG
AAGTGAAACGGGCATTACATACCGTCCTGTCGCCCAGGGCGGTTAACCTGCCGCTGCATCTGCGCGATGG
CATCTGGCAGGCTGACGTACATGACTCCACGCTGTTGCAGTCGGCCACCTTCGTGCTGGCGGTGGCGGCG
AAAATGGAGACGCTGCAACTCCAGCGCCAGTTTATCCAGCAGTCAAAAATTTCCTCGCCGGAAAAAATCC
GCAATATGGTCAGCGTGCAAATCCCCGGCATCCCGCTGCATACGCTGATGGTGGCCCCCCGCCAGCTTCC
GTACCATGCCGGTTTCAGCTATTTCGAACTGGACAAGAGCGGGGCCGCCTGGGCGGATGTGGCGGCCACC
GGCGCTGTCGCCCTGCATGTTTCCGGTACGTTCCCGGATCTGAACATGCAACTGTGGGCCATAAGAGGAT
AA