SecReT6
Protein ID: 198241800
SecReT6 ID302
T6SS typei1
Gene symbol-
Locus tagSeD_A1229
StrainSalmonella enterica subsp. enterica serovar Dublin str. CT_02021853
Repliconchromosome [GenBank: NC_011205] [Browse all T6SS(s) in this replicon]
Location [Strand]1223737..1225209 [-]
Producthypothetical protein
NoteTssC
UniProt IDB5FRS6
KEGG IDsed:SeD_A1229
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.50E-185, Aligned region: 68..489
Protein Sequence: 490 a.a.     [Download]
>gi|198241800|ref|YP_002215081.1| hypothetical protein SeD_A1229 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
MSLQEEELVSTRTEQGSHAPSLLDEIMAQTRIQPGADGYDIARQGVTAFIASLLQSTSPAEPVNKLAVDS
MIADIDARISRQMDAIIHAPQFQQLESFWRSMKALVDRVDFRENIKVHVLHVTKAELLEDFEFAPEITQS
GFYKHVYSSGFGQFGGEPIAAVLGAYEFKNTTPDMKLLNYVSAVGAMAHAPFLSSVSPEFMGLKSWTELP
NIKDLYAIFEGPAYTKWRALRDSEDSRYLGLTAPRFLLRQPYSATENPIKSFNYAEDVSHSHEHYLWGNT
AWMLASNIADSFAKYRWAPNIIGPQSGGAVKDLPVHLYESMGQIQAKIPTEVLITDRREFELAEEGFITL
TMRKNSDNAAFFSANSVQKPKHFPGKDAETNYKLGTQLPYLFIINRLAHYIKVLQREQLGSWKERSDLER
ELNIWVRQYVADQENPPADVRSRKPLRGAKVEVLDVDGEPGWYQVAISARPHFKYMGASFELSLVGRLDK
 
Nucleotide Sequence: 1473 bp     [Download]
>gi|198241740|ref|NC_011205.1|:c1225209-1223737 Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 chromosome, complete genome
ATGTCTTTACAGGAAGAAGAACTTGTTTCCACCCGCACTGAACAGGGAAGCCATGCCCCGTCGTTGCTTG
ATGAAATCATGGCACAAACCCGTATCCAGCCCGGCGCTGACGGTTATGATATTGCCCGTCAGGGCGTAAC
GGCTTTTATTGCCAGCCTCCTGCAATCCACTTCACCTGCAGAACCCGTAAACAAACTGGCCGTGGACAGC
ATGATTGCGGACATCGACGCCCGTATCAGCCGTCAGATGGATGCTATTATTCACGCCCCTCAGTTTCAGC
AACTGGAGTCGTTCTGGCGTTCAATGAAAGCGCTGGTCGATCGCGTTGATTTTCGTGAGAATATTAAGGT
GCATGTCCTCCATGTCACCAAAGCGGAATTGCTGGAAGATTTCGAGTTCGCGCCGGAGATTACCCAGTCC
GGCTTCTATAAGCATGTTTATTCCAGCGGGTTTGGGCAGTTTGGCGGCGAACCGATTGCGGCTGTGCTGG
GCGCATATGAGTTCAAAAATACCACGCCGGATATGAAGCTGCTGAACTATGTCAGCGCCGTCGGCGCAAT
GGCTCACGCGCCGTTCCTTTCTTCCGTGTCGCCGGAGTTTATGGGCCTGAAATCATGGACCGAGCTGCCC
AATATCAAGGATCTCTACGCCATTTTTGAAGGTCCGGCCTACACAAAATGGCGCGCCCTGCGTGATTCCG
AAGATTCCCGCTACCTGGGACTGACCGCGCCGCGTTTTCTGCTTCGCCAGCCCTATTCCGCGACCGAAAA
CCCGATTAAAAGCTTCAACTACGCCGAAGATGTGAGCCACAGCCACGAGCATTATTTGTGGGGCAATACC
GCCTGGATGCTGGCCAGTAATATAGCCGATTCGTTCGCGAAATACCGGTGGGCGCCCAATATTATCGGGC
CGCAGAGCGGCGGCGCAGTAAAAGATCTGCCGGTACATTTATATGAGTCAATGGGGCAGATTCAGGCCAA
GATCCCGACGGAGGTGTTGATCACCGACCGCCGTGAGTTCGAGCTGGCCGAAGAGGGGTTCATCACCCTG
ACCATGCGTAAAAACAGCGATAATGCGGCGTTTTTCTCGGCTAACAGCGTTCAGAAACCCAAGCATTTTC
CGGGCAAAGACGCCGAGACCAACTACAAGCTGGGTACGCAGTTGCCTTATCTGTTCATTATTAACCGCCT
CGCGCACTACATTAAGGTGCTGCAACGCGAGCAGCTTGGGTCGTGGAAAGAGAGAAGCGATCTGGAGCGG
GAGCTGAATATTTGGGTGCGCCAGTATGTCGCCGATCAGGAGAATCCGCCTGCTGATGTCCGCAGCCGTA
AGCCGCTGCGTGGCGCTAAAGTGGAGGTGCTGGATGTGGACGGCGAGCCGGGCTGGTATCAGGTGGCGAT
TTCCGCAAGGCCGCACTTTAAATATATGGGCGCGTCGTTTGAATTGTCTTTAGTCGGACGGTTAGATAAG
TGA