SecReT6
Protein ID: 198242271
SecReT6 ID302
T6SS typei1
Gene symbol-
Locus tagSeD_A1234
StrainSalmonella enterica subsp. enterica serovar Dublin str. CT_02021853
Repliconchromosome [GenBank: NC_011205] [Browse all T6SS(s) in this replicon]
Location [Strand]1227373..1229487 [+]
ProductVgr family type VI secretion system
NoteTssI
UniProt IDB5FRT1
KEGG IDsed:SeD_A1234
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.40E-65, Aligned region: 28..328
Phage_base_V [PF04717], Evalue: 1.40E-26, Aligned region: 366..458
Protein Sequence: 704 a.a.     [Download]
>gi|198242271|ref|YP_002215086.1| Vgr family type VI secretion system [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
MSTGLRFTLEVDGLPSDALVVESFHLSQSLSTLFSLDISLVSQQLHNIEFAQVLEKPAHLKIWQGTEIQR
RVNGIVTWFEQGENDGHQMLYSMKVRPPVWRAALRQNSRIFQNEDIKSILGTILQENGVTDWSPLFSEAH
PAREFCVQYSETDYDFLARMAAEEGIFFYEEHAQTSDDQSLVLCDTVRFLPEAFEIPWNPNTRTEVSTPC
VSQFRHSAQIRPSSVIGKDYTFKRPGWAGRFEHQGEHQDYQRTQYEVFDYPGRFKDGHGQNFARWQMEGW
RNNAEVAQGKSRSPAIWPGRRIQLTEHPQASLNREWQVVSSDLHGSQPQAAAGRSGSGTTLDNHFTVIPA
DRTWRPRPLPKPSVDGPQSAVVTGPEGEEIFCDEHGRVRVKFNWDRYNPANQDSSCWIRVVQAWAGPGFG
NLAIPRVGQEVIVDFLNGDPDQPIIMGRTYHQENRSPGSLPGTKTQMTIRSKTYKGSGFNELMFDDATGK
ERVYIHAQKNMNTEVLRNRTTDVTNNHAETIGNNQVIAVTNNQIQTIGVNQVEKVGSNQVIKVGANQVET
VGIVRALNVGLAYQTTVGGIMNTSVALMQSSEVGIFKSLNVGMKYNVNVGRNASVNVGNSKTESTGKTAV
YSAGEHLELVCGEARLVLTSDGGIFLNGKHIELQGVDSLNGDSKLISWNCGVSKKPPEASEQQDDPDPSD
LIMY
 
Nucleotide Sequence: 2115 bp     [Download]
>gi|198241740|ref|NC_011205.1|:1227373-1229487 Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 chromosome, complete genome
ATGTCAACAGGATTACGTTTCACACTGGAGGTGGACGGCCTGCCATCGGATGCGCTGGTCGTGGAGTCCT
TTCACCTGAGCCAGTCCCTTTCCACGTTATTTTCCCTCGATATCTCGCTGGTCAGTCAGCAACTTCACAA
CATTGAGTTTGCCCAGGTACTGGAAAAACCGGCGCACCTGAAAATCTGGCAGGGCACGGAGATACAGCGC
CGGGTGAACGGCATAGTGACCTGGTTTGAGCAGGGGGAAAACGACGGACACCAGATGCTGTACAGCATGA
AAGTTCGTCCGCCGGTGTGGCGCGCCGCGCTGCGGCAGAACTCGCGTATTTTCCAGAATGAAGACATAAA
AAGCATTCTCGGGACGATACTGCAGGAAAACGGCGTGACGGACTGGAGCCCGCTGTTCAGTGAGGCGCAT
CCGGCGCGGGAGTTCTGCGTGCAGTACAGCGAAACGGATTACGACTTTCTGGCGCGGATGGCGGCGGAGG
AAGGTATTTTCTTTTACGAGGAACATGCGCAGACCAGCGACGACCAGAGCCTGGTGCTGTGCGACACGGT
ACGTTTTCTGCCGGAAGCCTTTGAAATCCCCTGGAACCCGAACACCCGTACCGAGGTGAGCACGCCGTGC
GTCAGCCAGTTCCGCCACAGCGCGCAAATCCGCCCCTCTTCCGTCATCGGCAAGGACTACACCTTCAAAC
GCCCCGGCTGGGCGGGCCGCTTTGAGCACCAGGGCGAACATCAGGATTACCAGCGCACGCAGTATGAGGT
CTTTGATTATCCGGGGCGCTTCAAGGACGGCCACGGTCAGAACTTCGCCCGCTGGCAGATGGAAGGCTGG
CGTAATAATGCCGAAGTGGCGCAGGGGAAAAGCCGTTCGCCGGCGATATGGCCGGGACGGCGTATTCAGC
TGACGGAACACCCGCAGGCGAGCCTGAACCGGGAATGGCAGGTGGTGAGCAGCGATTTACACGGCAGCCA
GCCGCAGGCGGCGGCGGGGCGCTCAGGTTCAGGGACAACGCTGGACAATCATTTTACGGTCATCCCGGCA
GACAGAACATGGCGGCCACGCCCGCTGCCCAAACCATCAGTGGACGGCCCGCAGTCGGCGGTGGTCACCG
GCCCGGAAGGGGAAGAAATCTTCTGCGACGAACATGGCCGTGTACGGGTGAAATTTAACTGGGACCGGTA
TAACCCGGCGAACCAGGACAGCTCGTGCTGGATACGGGTGGTACAGGCGTGGGCGGGGCCGGGGTTCGGC
AACCTGGCGATACCGCGCGTGGGGCAGGAAGTGATAGTGGACTTCCTCAACGGCGACCCGGACCAGCCCA
TCATCATGGGGCGCACCTACCACCAGGAAAACCGCTCACCGGGCAGCCTGCCGGGCACCAAAACGCAGAT
GACCATCCGCTCGAAAACCTATAAAGGCAGCGGGTTTAACGAACTCATGTTTGATGATGCGACAGGGAAG
GAGCGCGTGTATATCCACGCGCAGAAGAATATGAATACCGAGGTGCTGCGCAACCGCACCACCGATGTGA
CGAATAATCATGCTGAAACCATTGGTAATAACCAGGTGATCGCCGTTACCAATAACCAAATCCAGACCAT
CGGCGTCAACCAGGTGGAGAAGGTGGGCAGTAACCAGGTGATCAAGGTGGGTGCCAATCAGGTGGAAACG
GTGGGGATTGTCCGCGCCCTGAATGTGGGGCTGGCATACCAGACTACCGTGGGCGGCATCATGAATACCT
CGGTGGCGCTGATGCAGTCTTCTGAGGTCGGGATCTTCAAATCACTGAATGTGGGAATGAAATACAACGT
CAATGTCGGGCGTAATGCCAGCGTTAACGTGGGCAACAGTAAAACCGAAAGTACCGGTAAAACGGCGGTG
TATTCCGCAGGCGAGCATCTGGAACTGGTGTGTGGTGAAGCCCGTCTGGTGCTGACGAGCGACGGCGGTA
TTTTTCTGAACGGCAAACATATTGAGTTGCAGGGCGTGGACAGCTTAAACGGGGATTCAAAGCTGATCAG
CTGGAACTGTGGGGTGAGCAAGAAGCCACCTGAAGCATCTGAACAGCAGGATGACCCCGATCCATCGGAT
CTGATCATGTACTGA