SecReT6
Protein ID: 198242376
SecReT6 ID302
T6SS typei1
Gene symbol-
Locus tagSeD_A1230
StrainSalmonella enterica subsp. enterica serovar Dublin str. CT_02021853
Repliconchromosome [GenBank: NC_011205] [Browse all T6SS(s) in this replicon]
Location [Strand]1225258..1225470 [-]
Producthypothetical protein
NoteTssC
UniProt IDB5FRS7
KEGG IDsed:SeD_A1230
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 0.002, Aligned region: 36..68
Protein Sequence: 70 a.a.     [Download]
>gi|198242376|ref|YP_002215082.1| hypothetical protein SeD_A1230 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
MGLREETSRTDDAITQAVIRLFISQTGDINTETLEVLVAALDQRIGCLMDEIIHINGYQQMKPHWRKVFH
 
Nucleotide Sequence: 213 bp     [Download]
>gi|198241740|ref|NC_011205.1|:c1225470-1225258 Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 chromosome, complete genome
ATGGGCTTGCGGGAAGAGACCTCCAGAACCGATGACGCAATAACGCAGGCAGTGATCCGGTTATTTATCA
GTCAGACAGGCGACATCAACACAGAAACACTGGAGGTATTGGTCGCGGCGCTTGACCAGAGGATCGGATG
TCTGATGGATGAAATCATCCATATCAACGGGTACCAGCAGATGAAGCCACACTGGCGAAAGGTGTTCCAC
TGA