SecReT6
Protein ID: 198242383
SecReT6 ID302
T6SS typei1
Gene symbol-
Locus tagSeD_A1224
StrainSalmonella enterica subsp. enterica serovar Dublin str. CT_02021853
Repliconchromosome [GenBank: NC_011205] [Browse all T6SS(s) in this replicon]
Location [Strand]1218573..1219106 [-]
Producttype VI secretion lipoprotein family protein
NoteTssJ
UniProt IDB5FRS1
KEGG IDsed:SeD_A1224
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.90E-33, Aligned region: 17..170
Protein Sequence: 177 a.a.     [Download]
>gi|198242383|ref|YP_002215076.1| type VI secretion lipoprotein family protein [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
MTGRGFLAWAMVALFTLALCGCETVKKIGEVIKNPDIQVGKLADQSSQVTITLLTEPDANINADGEAAAV
DVQLVYLSDDSKFQAADYDQIATTALPDALGKNYIDHQDFSLLPDTMKTLPPVKLDEKTQFIGVIAYFSD
DQTTEWKQIEPVEGTGHNYRLLVHIRQSSIEMKKEDD
 
Nucleotide Sequence: 534 bp     [Download]
>gi|198241740|ref|NC_011205.1|:c1219106-1218573 Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 chromosome, complete genome
ATGACAGGCCGTGGTTTCCTCGCCTGGGCGATGGTGGCGTTGTTCACCCTCGCCTTATGCGGTTGTGAAA
CGGTAAAAAAAATCGGCGAGGTGATTAAAAACCCGGATATTCAGGTCGGTAAGCTGGCAGACCAGTCTTC
GCAGGTGACGATTACGCTGCTGACGGAGCCGGATGCCAATATCAACGCGGACGGTGAAGCGGCTGCGGTG
GACGTGCAGCTGGTTTATCTGAGCGATGACTCAAAATTTCAGGCGGCCGACTACGACCAGATAGCCACCA
CCGCACTACCCGACGCGCTGGGGAAAAACTATATCGATCACCAGGATTTCAGCCTGCTGCCCGACACCAT
GAAAACCCTGCCGCCGGTGAAGCTGGATGAGAAAACGCAGTTTATCGGCGTGATTGCCTATTTTTCCGAC
GACCAGACTACGGAATGGAAGCAAATCGAACCGGTAGAAGGGACAGGACACAACTACCGCCTGCTGGTGC
ATATCCGGCAGAGCAGTATTGAAATGAAAAAAGAGGATGATTAA