SecReT6
Protein ID: 198242614
SecReT6 ID302
T6SS typei1
Gene symbol-
Locus tagSeD_A1216
StrainSalmonella enterica subsp. enterica serovar Dublin str. CT_02021853
Repliconchromosome [GenBank: NC_011205] [Browse all T6SS(s) in this replicon]
Location [Strand]1206170..1206649 [-]
ProductHNH endonuclease domain-containing protein
NoteTssD
UniProt IDB5FRR3
KEGG IDsed:SeD_A1216
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.80E-29, Aligned region: 6..143
Protein Sequence: 159 a.a.     [Download]
>gi|198242614|ref|YP_002215068.1| HNH endonuclease domain-containing protein [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
MANLIYLTLNGEKQGLISAGCCSLDSIGNKAQLLHLDHIMVYELTHGLSRDQNVNHHSVTIKKPVDKSSP
LLGKAINDNEILTCTFDFYRTNRFGINEKYYKLELKNARISDINFSIAHVVIDSEAQPQESISFIYESIN
WEHCIAGTSAFSLWDERVF
 
Nucleotide Sequence: 480 bp     [Download]
>gi|198241740|ref|NC_011205.1|:c1206649-1206170 Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 chromosome, complete genome
ATGGCCAATTTAATTTATTTAACACTGAACGGTGAAAAGCAAGGATTGATTTCAGCAGGTTGTTGTTCCC
TCGACTCTATCGGTAATAAAGCACAGTTACTGCACCTTGATCATATTATGGTATATGAACTGACACATGG
GTTAAGTCGGGATCAAAATGTCAATCATCATTCAGTTACGATAAAAAAACCTGTCGATAAATCATCTCCT
TTACTGGGAAAAGCAATTAACGATAATGAAATATTGACCTGCACTTTTGATTTTTATCGAACAAATCGAT
TTGGTATTAATGAAAAATATTACAAACTGGAATTAAAAAACGCCCGAATTAGTGATATTAATTTCTCGAT
TGCGCATGTAGTCATTGACAGTGAAGCACAACCTCAGGAAAGTATTTCTTTTATATATGAATCCATAAAC
TGGGAACACTGTATTGCCGGGACCAGTGCATTCAGTTTATGGGATGAGAGGGTGTTTTAG