SecReT6
Protein ID: 198242802
SecReT6 ID302
T6SS typei1
Gene symbol-
Locus tagSeD_A1233
StrainSalmonella enterica subsp. enterica serovar Dublin str. CT_02021853
Repliconchromosome [GenBank: NC_011205] [Browse all T6SS(s) in this replicon]
Location [Strand]1226633..1227151 [+]
Producthypothetical protein
NoteTssD
UniProt IDB5FRT0
KEGG IDsed:SeD_A1233
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.90E-35, Aligned region: 6..155
DCAF15_WD40 [PF14939], Evalue: 0.004, Aligned region: 93..136
Protein Sequence: 172 a.a.     [Download]
>gi|198242802|ref|YP_002215085.1| hypothetical protein SeD_A1233 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
MPTPCYISITGQTQGNITAGAFTADSVGNIYVQGHEDEMLVQEFLHNVTVPTDPQSGQPSGQRSHKPFIF
TVALNKAVPLLYNALASGEMLPKTELHWWRTSVEGKQEHYFTTRLTDSTIVDMKLHMPHCQDPAKREFTQ
LLEVSLAYRKIEWEHVKSGTSGADDWRAPLEA
 
Nucleotide Sequence: 519 bp     [Download]
>gi|198241740|ref|NC_011205.1|:1226633-1227151 Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 chromosome, complete genome
ATGCCAACACCGTGTTACATCTCAATTACGGGGCAAACCCAGGGCAATATCACCGCTGGTGCATTCACCG
CAGATTCTGTCGGCAATATCTACGTGCAGGGTCACGAGGATGAAATGCTGGTACAGGAATTCCTGCATAA
CGTGACCGTACCCACCGATCCACAGTCCGGGCAGCCGAGCGGCCAGCGTTCGCACAAGCCGTTCATTTTT
ACCGTGGCGCTGAACAAAGCCGTACCGCTGCTGTACAACGCGCTGGCGTCCGGTGAAATGCTGCCGAAAA
CCGAACTGCACTGGTGGCGTACTTCCGTTGAAGGCAAGCAGGAGCATTACTTCACCACCCGCCTGACGGA
CTCAACGATTGTGGATATGAAACTGCATATGCCGCACTGTCAGGACCCGGCAAAGCGCGAATTCACGCAG
TTGCTCGAAGTCTCGCTGGCCTACCGCAAAATCGAGTGGGAACACGTCAAATCCGGCACCTCTGGCGCGG
ATGACTGGCGCGCGCCGCTGGAAGCGTAA