SecReT6
Protein ID: 198243050
SecReT6 ID302
T6SS typei1
Gene symbolclpB
Locus tagSeD_A1221
StrainSalmonella enterica subsp. enterica serovar Dublin str. CT_02021853
Repliconchromosome [GenBank: NC_011205] [Browse all T6SS(s) in this replicon]
Location [Strand]1213728..1216463 [-]
Productchaperone protein clpB
NoteTssH
UniProt IDB5FRR8
KEGG IDsed:SeD_A1221
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.30E-38, Aligned region: 265..265
AAA_2 [PF07724], Evalue: 3.30E-38, Aligned region: 630..791
AAA [PF00004], Evalue: 5.80E-18, Aligned region: 30..57
AAA [PF00004], Evalue: 5.80E-18, Aligned region: 223..334
AAA [PF00004], Evalue: 5.80E-18, Aligned region: 636..754
AAA [PF00004], Evalue: 5.80E-18, Aligned region: 767..827
AAA_5 [PF07728], Evalue: 4.00E-14, Aligned region: 222..242
AAA_5 [PF07728], Evalue: 4.00E-14, Aligned region: 635..756
ClpB_D2-small [PF10431], Evalue: 1.80E-12, Aligned region: 797..873
AAA_16 [PF13191], Evalue: 2.00E-10, Aligned region: 24..75
AAA_16 [PF13191], Evalue: 2.00E-10, Aligned region: 199..239
AAA_16 [PF13191], Evalue: 2.00E-10, Aligned region: 263..300
AAA_16 [PF13191], Evalue: 2.00E-10, Aligned region: 465..486
AAA_16 [PF13191], Evalue: 2.00E-10, Aligned region: 610..676
AAA_16 [PF13191], Evalue: 2.00E-10, Aligned region: 701..729
AAA_22 [PF13401], Evalue: 1.10E-08, Aligned region: 25..66
AAA_22 [PF13401], Evalue: 1.10E-08, Aligned region: 221..307
AAA_22 [PF13401], Evalue: 1.10E-08, Aligned region: 634..669
AAA_14 [PF13173], Evalue: 1.90E-05, Aligned region: 222..351
AAA_14 [PF13173], Evalue: 1.90E-05, Aligned region: 635..725
AAA_25 [PF13481], Evalue: 3.20E-05, Aligned region: 222..246
AAA_25 [PF13481], Evalue: 3.20E-05, Aligned region: 282..307
AAA_25 [PF13481], Evalue: 3.20E-05, Aligned region: 630..664
AAA_25 [PF13481], Evalue: 3.20E-05, Aligned region: 795..827
NACHT [PF05729], Evalue: 7.70E-05, Aligned region: 222..250
NACHT [PF05729], Evalue: 7.70E-05, Aligned region: 436..462
NACHT [PF05729], Evalue: 7.70E-05, Aligned region: 636..664
AAA_29 [PF13555], Evalue: 0.00022, Aligned region: 215..239
AAA_29 [PF13555], Evalue: 0.00022, Aligned region: 633..660
AAA_19 [PF13245], Evalue: 0.00023, Aligned region: 219..243
AAA_19 [PF13245], Evalue: 0.00023, Aligned region: 627..657
DUF258 [PF03193], Evalue: 0.00028, Aligned region: 191..239
DUF258 [PF03193], Evalue: 0.00028, Aligned region: 636..654
Clp_N [PF02861], Evalue: 0.0011, Aligned region: 24..71
Clp_N [PF02861], Evalue: 0.0011, Aligned region: 117..123
AAA_18 [PF13238], Evalue: 0.0041, Aligned region: 223..242
AAA_18 [PF13238], Evalue: 0.0041, Aligned region: 636..671
Arch_ATPase [PF01637], Evalue: 0.0053, Aligned region: 202..236
Arch_ATPase [PF01637], Evalue: 0.0053, Aligned region: 275..309
Arch_ATPase [PF01637], Evalue: 0.0053, Aligned region: 636..656
Arch_ATPase [PF01637], Evalue: 0.0053, Aligned region: 706..717
Zeta_toxin [PF06414], Evalue: 0.0068, Aligned region: 222..241
Zeta_toxin [PF06414], Evalue: 0.0068, Aligned region: 634..675
AAA_17 [PF13207], Evalue: 0.0077, Aligned region: 222..263
AAA_17 [PF13207], Evalue: 0.0077, Aligned region: 636..670
Protein Sequence: 911 a.a.     [Download]
>gi|198243050|ref|YP_002215073.1| chaperone protein clpB [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
MIQIDLATLVKRLAPFAKQALEAAASECMSQQAAEITVAHVLLQMLATPRSDFRVIAERAEIGADDLRQA
LTVENYATARSSDSYPSFSPMLVEWLKEAWLLASAEMQQTELRGGVLLLALLHSPLRYLPPAAARLLTAI
NRDLLRQDFAGWTKESAESVILNADGQTASAIADTGDTLLARYAKNMTDDARQGRLDPVLCRDNEIDLMI
DILCRRRKNNPVVVGEAGVGKSALIEGLALRIIAGQVPDKLRDTDIMTLDLGALQAGASVKGEFEKRFKG
LMAEVIQSPKPVILFIDEAHTLIGAGNQQGGLDISNLLKPALARGELKTIAATTWSEYKKYFEKDSALSR
RFQLVKVSEPNAAEATIILRGLSAVYEQSHGVLIDDEALQAAATLSERYLSGRQLPDKAIDVLDTACARV
AINLSSPPRQISALTTLRQQCEAEIRQLEREIRIGLRSDTSRLNEVLAQYDETLSELDALEAAWRQQQTL
VQEIIALRKGLLDETDATGNDETATPETEAVGSDDESVTAPPEAEPEISPAARLAQLTAELDALHHTQLL
VSPHVDKKQIASVITEWTGVPLNRLSQNEMSVITDLPQWLGDTIKGQALAIKHLHKHLLTARADLRRPGR
PLGAFLLAGPSGVGKTETVLQLAELLYGGRQYLTTINMSEFQEKHTVSRLIGSPPGYVGYGEGGVLTEAI
RQKPYSVVLLDEVEKAHPDVLNLFYQAFDKGEMADGEGRLIDCKNVVFFLTSNLGYQVIVEHADNPEAMQ
EALYPVLADFFKPALLARMEVVPYLPLSRETLAVIIAGKLARLDNVLRARFGAEVVIEPEVTDEIMQRVT
RAENGARMLESVIDGEMLPPLSLLLLQKMAANIAIARITLGVANGAFTADVEDVPDEDTQPVAEAEDEAV
L
 
Nucleotide Sequence: 2736 bp     [Download]
>gi|198241740|ref|NC_011205.1|:c1216463-1213728 Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 chromosome, complete genome
ATGATCCAGATTGACTTAGCCACCCTGGTAAAACGGCTTGCTCCCTTCGCGAAACAGGCGCTGGAAGCGG
CGGCGTCGGAGTGTATGAGCCAGCAGGCGGCAGAAATTACCGTCGCGCATGTGCTGCTACAGATGCTGGC
GACCCCGCGCAGCGACTTTCGGGTGATTGCCGAACGTGCGGAGATCGGCGCCGATGATTTACGCCAGGCG
CTGACGGTGGAAAATTACGCCACCGCCCGTTCATCCGACAGCTACCCGTCGTTTTCCCCGATGCTGGTTG
AATGGCTGAAAGAGGCCTGGCTGCTGGCCTCCGCGGAAATGCAGCAGACCGAACTGCGCGGCGGCGTGCT
GCTGCTCGCCCTGCTGCATTCGCCGTTGCGCTACCTGCCGCCCGCCGCCGCCCGGTTGCTGACCGCCATC
AACCGCGACCTGCTCCGGCAGGATTTTGCCGGGTGGACGAAGGAGTCCGCCGAATCGGTGATCCTGAATG
CGGACGGACAGACCGCCAGCGCCATAGCCGATACCGGCGACACCCTGCTGGCCCGCTATGCCAAAAACAT
GACCGACGATGCCCGGCAGGGGCGGCTTGATCCGGTGCTGTGCCGCGATAACGAAATTGACCTGATGATC
GATATCCTCTGCCGCCGCCGTAAAAATAATCCGGTGGTGGTGGGCGAAGCGGGCGTGGGCAAAAGCGCGC
TGATTGAAGGGCTGGCGCTGCGCATTATTGCCGGTCAGGTGCCGGACAAACTGCGCGATACCGATATTAT
GACGCTGGATCTCGGCGCATTACAGGCGGGCGCGTCGGTGAAAGGTGAATTTGAGAAGCGCTTTAAGGGG
CTGATGGCGGAAGTCATTCAGTCGCCGAAACCCGTCATCCTGTTTATCGACGAAGCCCACACGCTGATTG
GCGCGGGCAACCAGCAGGGCGGGCTGGATATCTCCAACCTGCTCAAACCGGCACTGGCGCGCGGCGAGCT
GAAAACCATCGCCGCCACCACCTGGAGCGAATACAAAAAATACTTCGAGAAAGACTCCGCCCTGTCGCGC
CGTTTCCAGTTAGTGAAAGTCAGCGAACCCAATGCTGCCGAAGCCACCATTATTCTGCGCGGCCTGTCGG
CGGTGTATGAGCAGTCCCACGGCGTGCTGATTGACGATGAAGCCTTACAGGCCGCTGCGACGTTGAGCGA
GCGCTACCTGTCAGGCCGCCAGTTGCCGGATAAGGCCATTGATGTGCTGGATACCGCCTGCGCCCGCGTG
GCGATTAACCTCTCCTCGCCGCCGAGACAAATCTCGGCGCTGACCACCCTGCGCCAGCAGTGTGAAGCGG
AAATCCGCCAGCTTGAGCGTGAGATCCGTATTGGCCTGCGGTCGGACACCTCACGGCTAAACGAGGTTCT
GGCGCAGTATGACGAAACGCTGAGCGAACTGGATGCGCTGGAGGCCGCGTGGCGCCAGCAGCAGACGCTG
GTGCAGGAGATTATCGCGCTGCGTAAGGGGCTGCTGGACGAAACGGACGCTACCGGCAACGACGAAACCG
CAACGCCTGAAACAGAGGCGGTGGGCAGTGACGATGAATCCGTCACAGCGCCGCCGGAAGCGGAACCGGA
AATTTCGCCAGCCGCCCGCCTCGCGCAGCTCACCGCCGAACTGGACGCCCTGCACCACACGCAGCTGCTG
GTCTCCCCACACGTCGATAAAAAACAGATAGCCAGCGTGATTACCGAATGGACCGGCGTGCCGCTTAACC
GCCTGTCACAAAACGAAATGTCGGTCATCACCGACCTGCCGCAGTGGCTGGGCGACACCATTAAAGGCCA
GGCGCTGGCGATTAAGCACCTGCACAAACACCTGCTGACCGCCCGCGCCGATCTGCGCCGTCCGGGACGC
CCGCTCGGCGCGTTCCTGCTGGCCGGTCCCAGCGGTGTCGGCAAAACCGAAACCGTGCTGCAACTGGCCG
AACTGCTCTACGGCGGTCGCCAGTACCTGACCACCATCAATATGTCGGAGTTTCAGGAGAAACACACCGT
TTCACGCCTGATTGGTTCGCCGCCGGGCTATGTCGGCTACGGCGAGGGCGGCGTGCTGACCGAAGCGATT
CGTCAGAAACCGTACTCCGTGGTGCTGCTCGACGAGGTGGAGAAAGCCCACCCGGACGTGCTCAACCTGT
TCTACCAGGCGTTCGACAAGGGCGAGATGGCCGATGGCGAAGGGCGTCTTATCGACTGTAAAAATGTGGT
GTTCTTCCTCACCTCCAACCTCGGCTATCAGGTGATTGTCGAACATGCCGACAACCCGGAAGCCATGCAG
GAAGCGCTGTACCCGGTACTGGCGGACTTCTTTAAACCGGCGCTGCTGGCGCGTATGGAAGTGGTGCCGT
ACCTGCCGTTATCCAGAGAAACGCTTGCCGTCATTATCGCCGGGAAGCTGGCGCGGCTGGACAACGTACT
GCGCGCCCGCTTCGGCGCGGAGGTGGTGATTGAGCCGGAGGTGACCGACGAAATCATGCAGCGCGTCACC
CGCGCCGAAAACGGCGCGCGGATGCTGGAGTCGGTCATCGACGGCGAGATGCTGCCGCCGCTCTCCCTGC
TGCTGTTGCAGAAAATGGCGGCGAATATCGCCATTGCCCGTATCACGCTGGGCGTGGCAAACGGCGCGTT
TACCGCGGATGTGGAGGATGTGCCGGATGAGGATACTCAGCCCGTAGCGGAAGCAGAGGACGAAGCCGTT
CTATGA