SecReT6
Protein ID: 198243146
SecReT6 ID302
T6SS typei1
Gene symbol-
Locus tagSeD_A1227
StrainSalmonella enterica subsp. enterica serovar Dublin str. CT_02021853
Repliconchromosome [GenBank: NC_011205] [Browse all T6SS(s) in this replicon]
Location [Strand]1221466..1223319 [-]
Producthypothetical protein
NoteTssF
UniProt IDB5FRS4
KEGG IDsed:SeD_A1227
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.60E-192, Aligned region: 5..617
Protein Sequence: 617 a.a.     [Download]
>gi|198243146|ref|YP_002215079.1| hypothetical protein SeD_A1227 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
MEFEERYYRQELDHLRQLSKLLATEKPHLARFLAEKEADPDIERLLEGVAFLTGNLRQKIEDEFPELTHG
LIRMLWPNYLRPVPSMTLIEYTPDMDKTSVPVLIPRNEQFTTGAKGTQGNPVLSAYSGNEHDVAPPCTFT
LCRDIWLLPVQLDQVENRSTPRHGIIDITFAVAPGTDFATLDLNRLRFWLGNDDNYTRYQLYLWFCEYLQ
GAELMAGGQSSPMPEFMLKAVGFESEDAMLPWPGNVHSGYRILQEFFCYADSFLFFDACGIPALPDRLKE
NRFTLRLRFSRPLPADIRLRDDSLRLYCAPAINLFAHHAEAITLDHQRQDYALVPSRHFPDHYDIFSVNS
VVSQTQGKQRKADLGRPVITEAARHWPAFESFRHQMEYSRKREVVYWQHRTRTSLFHRGFDHTLAFIHAD
GSLPDASLLNNEVVSVSLTCTNRELPVQLRPGDITGTTGKNASVASFRNITRPTRPLWPVIDGSLHWSLL
SAMNLNYLSLLDADALKQVIANFDRHAIHHPQMARLSQQKLDAIERLETTPVDRLFTGIPVRGLASTLSI
HPEPFVCEGEMYLLGAVLSHFLSLYASVNSFHMLTVVNTESQESWKWAERTGQHPLI
 
Nucleotide Sequence: 1854 bp     [Download]
>gi|198241740|ref|NC_011205.1|:c1223319-1221466 Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 chromosome, complete genome
ATGGAATTCGAAGAACGCTATTACAGGCAGGAGTTGGATCACCTGCGGCAGTTGAGCAAGCTGCTGGCGA
CCGAAAAGCCGCATCTGGCCCGGTTTCTGGCAGAAAAAGAGGCCGATCCGGATATCGAGCGTCTGCTGGA
GGGCGTGGCCTTTCTGACCGGCAATCTGCGCCAGAAAATCGAGGATGAGTTTCCGGAGCTGACGCACGGA
CTGATCCGGATGCTGTGGCCCAATTATCTGCGCCCGGTGCCGTCGATGACGCTGATTGAATATACGCCGG
ATATGGATAAAACTTCCGTGCCGGTACTGATCCCCCGTAATGAGCAGTTCACAACCGGGGCGAAGGGGAC
TCAGGGAAACCCGGTATTGTCTGCGTATTCCGGCAATGAGCACGATGTAGCCCCGCCCTGTACGTTCACC
CTGTGCCGGGATATCTGGCTGTTACCCGTTCAACTGGATCAGGTTGAAAATCGCAGTACGCCCCGCCACG
GCATTATTGATATTACGTTTGCCGTCGCACCGGGCACTGATTTTGCCACGCTGGATCTGAACAGGCTGCG
CTTCTGGCTGGGCAACGATGATAACTATACCCGCTATCAGCTTTATCTGTGGTTTTGTGAATATTTACAG
GGCGCAGAGTTGATGGCGGGCGGGCAGTCGAGCCCGATGCCTGAATTTATGCTGAAAGCGGTGGGTTTTG
AGTCAGAGGACGCCATGCTGCCCTGGCCCGGCAATGTCCACAGCGGCTACCGCATTCTCCAGGAGTTTTT
CTGCTACGCCGACAGTTTTCTGTTTTTCGATGCCTGTGGCATTCCGGCATTGCCAGACAGGTTAAAGGAG
AACCGTTTCACTCTGCGGCTGCGGTTTTCTCGCCCCTTACCGGCAGATATCCGGCTGCGGGATGATTCCC
TGCGCTTATATTGTGCGCCCGCCATTAATCTGTTTGCCCACCATGCCGAAGCCATCACGCTGGATCATCA
GCGGCAGGATTACGCTCTGGTTCCCAGCCGTCATTTTCCGGATCATTACGACATTTTTTCGGTTAACAGC
GTGGTGAGTCAGACGCAGGGGAAGCAGAGAAAAGCGGATCTTGGACGGCCGGTGATCACAGAGGCCGCGC
GCCACTGGCCTGCTTTTGAGAGTTTCCGCCACCAGATGGAGTACAGCCGTAAGCGGGAAGTGGTCTACTG
GCAGCACCGGACCAGGACCTCGCTGTTTCACCGGGGCTTTGATCATACCCTAGCTTTTATTCATGCCGAT
GGCAGCCTCCCGGATGCCTCACTGCTTAATAATGAAGTGGTTTCTGTATCGCTGACCTGCACCAACCGGG
AGCTGCCGGTACAGCTACGGCCCGGCGATATCACCGGTACGACAGGTAAAAACGCGTCGGTGGCGTCATT
TCGCAATATCACCCGCCCCACCAGACCGCTCTGGCCGGTGATTGACGGCAGCCTGCACTGGTCGTTGCTG
TCTGCCATGAACCTGAATTATCTGTCGTTGCTGGATGCTGATGCGCTCAAACAGGTGATCGCCAATTTTG
ATCGCCACGCCATCCATCATCCGCAGATGGCCCGTCTGTCACAGCAGAAGCTGGACGCCATTGAACGGCT
GGAAACAACCCCGGTTGATCGCCTGTTTACCGGCATACCGGTGCGCGGGCTGGCGTCCACCCTGTCCATT
CATCCGGAGCCGTTTGTCTGCGAGGGTGAAATGTACCTGCTGGGCGCGGTGCTGTCGCATTTTCTGTCGC
TGTACGCCAGCGTCAATTCGTTCCACATGCTGACCGTCGTTAACACGGAAAGCCAGGAGTCATGGAAATG
GGCGGAAAGAACCGGGCAACACCCGCTCATCTGA