SecReT6
Protein ID: 198243684
SecReT6 ID302
T6SS typei1
Gene symbol-
Locus tagSeD_A1228
StrainSalmonella enterica subsp. enterica serovar Dublin str. CT_02021853
Repliconchromosome [GenBank: NC_011205] [Browse all T6SS(s) in this replicon]
Location [Strand]1223324..1223740 [-]
Producthypothetical protein
NoteTssE
UniProt IDB5FRS5
KEGG IDsed:SeD_A1228
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.70E-15, Aligned region: 32..115
Protein Sequence: 138 a.a.     [Download]
>gi|198243684|ref|YP_002215080.1| hypothetical protein SeD_A1228 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
MIPAREKPAGSLFERLENPPARNWREGSNIEAFRQSIRHSLRNILNTRSGSCRGTPGLGIEEPEGSDNYR
SAMSQAIVQCIERYEPRISHAEVRAILPQAASPQEIIFRITAWVTFNDIDDVLEFDMAPDGSQHYRVE
 
Nucleotide Sequence: 417 bp     [Download]
>gi|198241740|ref|NC_011205.1|:c1223740-1223324 Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 chromosome, complete genome
GTGATACCGGCGCGCGAAAAGCCTGCCGGATCGCTGTTTGAGCGTCTGGAAAACCCTCCTGCCAGAAACT
GGCGGGAGGGCAGTAATATAGAGGCGTTCAGGCAGTCCATTCGCCATAGTCTGCGCAATATCCTGAACAC
CCGCTCCGGCAGTTGTCGGGGAACACCGGGGCTGGGTATTGAAGAGCCGGAAGGGTCGGATAATTACCGC
AGCGCCATGAGCCAGGCCATCGTGCAGTGTATTGAGCGTTATGAACCCCGGATTTCGCACGCGGAGGTCC
GGGCAATCCTGCCACAGGCCGCCAGCCCACAGGAGATAATTTTTCGTATCACCGCCTGGGTGACATTTAA
CGATATCGACGATGTGCTGGAGTTTGATATGGCACCGGACGGTAGTCAGCATTATCGGGTGGAGTAG