SecReT6
Protein ID: 198243709
SecReT6 ID302
T6SS typei1
Gene symbol-
Locus tagSeD_A1222
StrainSalmonella enterica subsp. enterica serovar Dublin str. CT_02021853
Repliconchromosome [GenBank: NC_011205] [Browse all T6SS(s) in this replicon]
Location [Strand]1216476..1217234 [-]
Producthypothetical protein
NoteTssL
UniProt IDB5FRR9
KEGG IDsed:SeD_A1222
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 9.40E-63, Aligned region: 30..234
Protein Sequence: 252 a.a.     [Download]
>gi|198243709|ref|YP_002215074.1| hypothetical protein SeD_A1222 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
MDELSLPPLPGYEREGQRQYQLALRGNSLNPMIDAATPLLGMVMRVSGMNSHAMPEHLFTQVVTDVQAVE
QLLQEQGYEPGVIISFRYILCTFIDEAALGNGWSNKNEWIKQSLLVHFHNEAWGGEKVFILLERLMREPK
RYQDLLEFLYICFSLGFRGRYKVAVQDQGEFEQIYRRLYHVLHKLRGDAPFPLLHQDKKTQGGRYQLIKR
LTIRHVLCGGIVVLALFYLFYLLRLDSQTQDILHQLNRLLAR
 
Nucleotide Sequence: 759 bp     [Download]
>gi|198241740|ref|NC_011205.1|:c1217234-1216476 Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 chromosome, complete genome
ATGGATGAGCTGTCACTGCCCCCTTTACCCGGATACGAGAGAGAAGGCCAGCGCCAGTATCAGCTGGCGC
TGCGCGGCAACAGCCTGAACCCGATGATCGATGCCGCCACCCCGCTGCTGGGGATGGTGATGCGCGTTTC
GGGCATGAACAGCCATGCCATGCCTGAACACCTGTTCACCCAGGTGGTGACGGATGTGCAGGCGGTGGAG
CAGTTACTCCAGGAGCAGGGCTATGAGCCTGGGGTGATTATCTCGTTTCGTTACATCCTGTGTACCTTTA
TTGACGAGGCGGCGCTGGGGAATGGCTGGTCGAACAAAAACGAGTGGATCAAGCAGTCGCTGCTGGTGCA
TTTCCATAACGAAGCCTGGGGCGGTGAAAAGGTTTTTATCCTGCTGGAGCGCCTGATGCGCGAACCCAAA
CGCTACCAGGATCTGCTGGAATTTTTGTACATCTGCTTTTCGCTGGGCTTTCGCGGGCGTTATAAAGTCG
CCGTCCAGGACCAGGGGGAGTTTGAGCAGATATACCGCCGCCTGTATCACGTCCTGCATAAGCTGCGCGG
CGATGCGCCCTTTCCGCTGCTGCACCAGGATAAAAAAACCCAGGGCGGGCGCTATCAGCTGATTAAACGG
CTGACCATCCGGCATGTTCTGTGCGGCGGCATCGTCGTGCTGGCGCTGTTTTATCTGTTTTATCTGCTGC
GTCTGGACAGTCAGACGCAGGACATTCTTCATCAGTTAAACCGGCTGCTTGCCAGGTAA