SecReT6
Protein ID: 198243822
SecReT6 ID302
T6SS typei1
Gene symbol-
Locus tagSeD_A1226
StrainSalmonella enterica subsp. enterica serovar Dublin str. CT_02021853
Repliconchromosome [GenBank: NC_011205] [Browse all T6SS(s) in this replicon]
Location [Strand]1220414..1221502 [-]
Producthypothetical protein
NoteTssG
UniProt IDB5FRS3
KEGG IDsed:SeD_A1226
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.30E-88, Aligned region: 34..349
Protein Sequence: 362 a.a.     [Download]
>gi|198243822|ref|YP_002215078.1| hypothetical protein SeD_A1226 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
MGGKNRATPAHLSPDDAPAQDEQRTLREPLFQDACACNFFALSELLHRLASEGGETPVLSLDTPPAQETI
RFQADASLGFPVSDVSALEQDASGLFRMTTTFMGLQGSQSPLPGYYLDHLAWKSAHEQSPVSDFLDMFSH
RLTQFVWHIWRKYRYHVAFRNGGVDAFSQRMYSLVGLGHRQLRDSLPVNHSKMLAYAGILANPGRSPEIV
CTLVAHCFDLNLSDVTLQNWQRRMVDIEPDQQNSLGCYTIKNGEKLAGRSVLGNFVLGTRVPDLSGKFQL
SINHLSRKQFLSFLPSGENFLPLAMFVSFVLRDQLAWDLHLGLAPDQVGIMRLGDNKSALLGWTSFLGEP
GEHPSVTIRVRE
 
Nucleotide Sequence: 1089 bp     [Download]
>gi|198241740|ref|NC_011205.1|:c1221502-1220414 Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 chromosome, complete genome
ATGGGCGGAAAGAACCGGGCAACACCCGCTCATCTGAGTCCGGACGATGCTCCGGCGCAGGATGAACAAC
GCACGCTGCGGGAGCCGTTGTTTCAGGACGCCTGCGCCTGCAATTTTTTCGCGCTCTCTGAGCTGCTGCA
CCGGCTGGCATCAGAAGGCGGCGAAACGCCAGTGTTATCCCTGGATACCCCTCCGGCGCAGGAAACCATT
CGTTTCCAGGCGGACGCCAGCCTGGGATTTCCGGTAAGCGATGTCAGCGCGCTGGAGCAGGATGCTTCCG
GGTTGTTCCGGATGACCACCACCTTTATGGGATTGCAGGGCAGCCAGTCGCCCCTCCCCGGCTATTACCT
TGATCACCTGGCCTGGAAATCCGCGCACGAGCAGAGTCCGGTCAGCGATTTTCTGGATATGTTCAGCCAT
CGCCTGACGCAGTTTGTCTGGCATATCTGGCGTAAGTACCGTTACCACGTCGCTTTCCGTAACGGCGGCG
TGGATGCGTTCTCGCAGCGGATGTACTCCCTGGTGGGGCTGGGCCACCGGCAGCTTCGCGACAGTCTGCC
CGTTAACCACAGCAAAATGCTGGCCTATGCCGGGATACTGGCAAATCCGGGACGTTCGCCGGAGATCGTC
TGTACGCTGGTTGCGCACTGTTTCGATTTAAATTTATCGGACGTGACGCTGCAAAACTGGCAGCGGCGGA
TGGTGGATATCGAGCCGGATCAGCAGAACAGTCTTGGATGTTACACGATTAAAAATGGCGAAAAACTGGC
CGGGCGATCGGTGCTGGGTAATTTTGTCCTCGGTACGCGGGTTCCCGATCTCAGCGGTAAATTTCAGTTA
AGTATTAACCACCTGAGCCGCAAGCAGTTTCTCTCGTTCCTGCCGTCAGGAGAAAATTTTCTGCCGCTGG
CGATGTTTGTCTCCTTCGTCCTGCGCGATCAGCTTGCCTGGGATTTACACCTGGGGCTGGCCCCGGATCA
GGTGGGGATTATGCGGCTGGGCGATAACAAGAGCGCGCTGCTGGGCTGGACGTCATTTCTCGGCGAGCCG
GGAGAGCATCCCTCAGTCACCATCAGGGTCAGGGAGTAA