SecReT6
Protein ID: 198244689
SecReT6 ID301
T6SS typei3
Gene symbol-
Locus tagSeD_A0301
StrainSalmonella enterica subsp. enterica serovar Dublin str. CT_02021853
Repliconchromosome [GenBank: NC_011205] [Browse all T6SS(s) in this replicon]
Location [Strand]318558..319049 [+]
ProductSciN protein
NoteTssJ
UniProt IDB5FJ71
KEGG IDsed:SeD_A0301
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.40E-41, Aligned region: 5..156
Protein Sequence: 163 a.a.     [Download]
>gi|198244689|ref|YP_002214232.1| SciN protein [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
MPFALLLLSGCGSSDALPDLESQRLDLSVKASDKVNPDNQKKAAPIEIRVYELKNDAAFTTADYWSLHDN
DKSVLTDDLVRRDSFILRPGEEKKLRRPLNAQTTAIGVLAGYRNLAKSVWRVTYKIPEAPEKAWYSNFIP
GKGKVQLDAELEQSAIVITERDK
 
Nucleotide Sequence: 492 bp     [Download]
>gi|198241740|ref|NC_011205.1|:318558-319049 Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 chromosome, complete genome
ATGCCTTTTGCACTGCTCCTGCTTTCCGGATGCGGCAGTAGCGATGCGTTACCTGACCTCGAATCACAGC
GACTCGACCTGAGCGTGAAAGCCTCCGATAAGGTGAATCCTGACAATCAGAAGAAGGCCGCGCCCATTGA
GATACGTGTTTATGAACTGAAAAATGACGCCGCTTTCACGACAGCTGATTACTGGTCGCTCCATGACAAC
GACAAATCCGTCCTTACCGACGATTTAGTGCGTCGCGACAGCTTTATTTTGCGTCCCGGCGAAGAGAAAA
AACTGCGTCGCCCGCTGAATGCGCAGACCACGGCAATCGGCGTACTGGCCGGATACCGTAACCTGGCCAA
ATCGGTCTGGCGGGTAACCTACAAAATCCCGGAAGCCCCGGAAAAAGCCTGGTACAGCAACTTCATACCG
GGGAAAGGAAAAGTGCAGTTGGATGCGGAACTGGAACAAAGCGCTATTGTAATTACGGAACGGGATAAAT
GA