SecReT6
Protein ID: 198244825
SecReT6 ID302
T6SS typei1
Gene symbol-
Locus tagSeD_A1219
StrainSalmonella enterica subsp. enterica serovar Dublin str. CT_02021853
Repliconchromosome [GenBank: NC_011205] [Browse all T6SS(s) in this replicon]
Location [Strand]1211580..1212992 [-]
ProductImpA domain-containing protein
NoteTssA
UniProt IDB5FRR6
KEGG IDsed:SeD_A1219
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.80E-09, Aligned region: 52..109
Protein Sequence: 470 a.a.     [Download]
>gi|198244825|ref|YP_002215071.1| ImpA domain-containing protein [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
MDLRDPNTWISHLLENLPDDKLACALKDDDPDWEYIDGEMLKLGSLAHSQLDIPEIQRRGLVILASESKD
FRLLAHLLRTLQHAGDPLLALRLLALYVEHYWTVAAPQNAAHKQRFATQVLKRFETGVESFAETARTAQR
DSLLAELAKLAQRWQEQNIPALAQAVDDLSSQYRRAFRGAAPVPPAAGPSTPPAPVSATPSAPVSPSAPA
ATTAPPVDIDSHDDKAWRDTLLKVAAILCERQPDSPQGYRLRRHALWQAITSVPQAESDGRTPLAAVPAD
MTADYQARLNNADLALWQQVEKSLLLAPYWLDGHYLSAQAAQRLGYTSAAEAIRDEVVRFLARLPQLATL
LFNDRTPFISEQTKQWLAASPGSQTAPMVRTSEDTEAVRQCFSEQGLEATLRYLETLPEGDPRDRFHRQY
LGAQLLEEAGMAQLAQQQYRMLFKAGLRMTLAEWEPSLLEQLENKLTAEQ
 
Nucleotide Sequence: 1413 bp     [Download]
>gi|198241740|ref|NC_011205.1|:c1212992-1211580 Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 chromosome, complete genome
ATGGACTTACGCGACCCGAATACCTGGATTTCGCACCTGCTGGAAAATCTGCCGGATGACAAACTGGCCT
GCGCGCTGAAAGACGATGATCCTGACTGGGAATATATCGACGGCGAAATGCTTAAACTCGGCTCGCTGGC
GCACAGTCAGCTGGATATCCCGGAAATTCAGCGCCGGGGGCTGGTGATTCTGGCCTCGGAAAGCAAGGAT
TTTCGCCTGCTGGCCCATCTGCTGCGCACCCTGCAACATGCCGGCGATCCGCTGCTGGCGCTGCGTCTGC
TGGCGCTGTACGTGGAGCATTACTGGACGGTGGCGGCACCACAAAATGCGGCACATAAACAGCGTTTCGC
CACCCAGGTGCTGAAACGCTTTGAAACCGGCGTGGAGAGTTTCGCAGAGACAGCCCGTACCGCGCAGCGC
GACAGCCTGCTGGCTGAACTGGCGAAACTGGCGCAGCGCTGGCAGGAGCAGAATATCCCGGCGCTGGCAC
AGGCCGTCGATGACCTCTCGTCGCAGTATCGCCGGGCATTTCGCGGGGCCGCCCCGGTGCCGCCAGCGGC
TGGCCCGTCCACGCCTCCGGCTCCGGTTTCGGCCACGCCGTCCGCCCCGGTATCCCCGTCTGCGCCTGCG
GCGACGACGGCGCCACCGGTGGATATCGACAGCCATGACGACAAAGCCTGGCGCGACACGCTGCTGAAAG
TGGCCGCCATTCTCTGTGAGCGCCAGCCGGATTCACCGCAGGGCTACCGCCTGCGCCGCCATGCGTTATG
GCAGGCCATTACATCCGTCCCCCAGGCCGAAAGCGACGGGCGCACACCGCTGGCGGCGGTGCCTGCCGAC
ATGACCGCCGATTACCAGGCGCGGCTGAACAACGCCGATCTGGCGCTCTGGCAACAGGTGGAAAAAAGCC
TGCTGCTGGCCCCGTACTGGCTCGATGGTCATTACCTTTCAGCGCAGGCCGCACAACGCCTGGGCTACAC
CAGCGCGGCAGAAGCCATCCGGGATGAGGTGGTTCGCTTTCTCGCCCGCCTGCCGCAACTTGCCACCCTG
CTGTTTAATGACCGCACACCGTTTATCAGCGAACAGACAAAACAGTGGCTGGCGGCGTCTCCGGGCAGTC
AGACAGCCCCGATGGTGCGGACCAGTGAAGACACCGAGGCCGTCCGCCAGTGTTTCAGCGAGCAGGGGCT
GGAGGCCACGCTGCGATACTTGGAAACCCTGCCGGAAGGCGATCCGCGCGATCGGTTCCACCGGCAGTAT
CTTGGCGCGCAACTGTTAGAAGAAGCCGGGATGGCGCAACTGGCACAGCAACAGTACCGGATGTTGTTTA
AAGCAGGGCTGCGCATGACGCTGGCTGAATGGGAGCCGTCCCTGCTGGAACAACTGGAAAACAAACTCAC
GGCAGAACAGTAA