SecReT6
Protein ID: 198245445
SecReT6 ID301
T6SS typei3
Gene symbol-
Locus tagSeD_A0290
StrainSalmonella enterica subsp. enterica serovar Dublin str. CT_02021853
Repliconchromosome [GenBank: NC_011205] [Browse all T6SS(s) in this replicon]
Location [Strand]306567..307502 [-]
ProductSciB protein
NoteTssG
UniProt IDB5FJ61
KEGG IDsed:SeD_A0290
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.30E-90, Aligned region: 10..290
Protein Sequence: 311 a.a.     [Download]
>gi|198245445|ref|YP_002214222.1| SciB protein [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
MRRVDAQLCDTPAGSIWQPRMEKFRLGQTPTMTFAPREIAQVSWQDGRLHLSLYSLGLWGPNGPLPLHYT
ELALNRSESRHDPTLVHFSNIFHHRWLTQFWQAWRSAQSAGGGLDKPEHDRFAFYIASLSGQDLRESAES
PLSDHVRLAASAHLVRESRNPDGLAATLAHYFSVPFAVKEFALHWITVANDEITRLGTPAQSSVLGNGAL
IGQAVPDMQYKFRLIIGPLTLEDYLRFLPGGNNLPVLTELVRTFIGFEYCWEIELQLKPHAAPPAVIGGA
QRLGWTAWAGKAMHDRPVTGMIFEPEHGLTH
 
Nucleotide Sequence: 936 bp     [Download]
>gi|198241740|ref|NC_011205.1|:c307502-306567 Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 chromosome, complete genome
ATGCGGCGCGTGGATGCCCAGCTCTGTGATACTCCGGCAGGCAGTATCTGGCAGCCACGGATGGAAAAAT
TCCGTCTGGGACAGACGCCGACGATGACCTTTGCGCCACGGGAAATCGCCCAGGTCAGCTGGCAGGATGG
ACGCCTGCACCTGAGCCTGTACAGCCTCGGACTATGGGGGCCAAACGGCCCGTTGCCGCTGCACTATACC
GAGCTGGCGCTAAACCGCTCAGAGAGTCGTCACGATCCGACGCTGGTTCATTTTTCCAATATTTTTCACC
ACCGCTGGCTAACGCAGTTCTGGCAGGCATGGCGCAGCGCCCAGTCCGCTGGTGGCGGGCTGGACAAACC
GGAACACGACCGTTTTGCGTTTTATATCGCCAGTCTCAGCGGGCAGGATCTACGGGAAAGCGCCGAAAGC
CCGCTGTCAGATCATGTTCGCCTGGCAGCCTCCGCCCATCTGGTACGCGAATCGCGCAATCCTGACGGGC
TGGCCGCCACGCTGGCGCACTATTTCAGCGTACCTTTTGCGGTGAAAGAGTTCGCCCTGCACTGGATAAC
GGTGGCGAACGATGAAATCACCCGTCTGGGCACGCCCGCGCAGTCTTCGGTGCTGGGCAACGGGGCGCTT
ATCGGCCAGGCCGTACCGGATATGCAGTACAAATTCCGGCTAATTATCGGCCCGCTCACGCTGGAGGATT
ACCTGCGTTTTCTGCCCGGCGGCAACAATCTGCCCGTGCTGACAGAACTGGTGCGTACGTTCATTGGTTT
TGAATATTGCTGGGAAATTGAGCTGCAGTTGAAGCCTCATGCCGCACCGCCTGCGGTGATCGGCGGCGCG
CAGCGGCTTGGCTGGACGGCCTGGGCAGGTAAAGCCATGCATGACCGTCCGGTGACCGGCATGATTTTTG
AACCTGAACACGGCTTAACCCACTGA