SecReT6
Protein ID: 198246064
SecReT6 ID302
T6SS typei1
Gene symbol-
Locus tagSeD_A1217
StrainSalmonella enterica subsp. enterica serovar Dublin str. CT_02021853
Repliconchromosome [GenBank: NC_011205] [Browse all T6SS(s) in this replicon]
Location [Strand]1206665..1208029 [-]
ProductImpA domain-containing protein
NoteTssA
UniProt IDB5FRR4
KEGG IDsed:SeD_A1217
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 2.00E-45, Aligned region: 93..156
DUF3702 [PF12486], Evalue: 2.00E-45, Aligned region: 262..271
DUF3702 [PF12486], Evalue: 2.00E-45, Aligned region: 292..438
ImpA-rel_N [PF06812], Evalue: 2.30E-21, Aligned region: 41..100
ImpA-rel_N [PF06812], Evalue: 2.30E-21, Aligned region: 238..265
Protein Sequence: 454 a.a.     [Download]
>gi|198246064|ref|YP_002215069.1| ImpA domain-containing protein [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
MSQDALTHIIVTGQDPRGLPEFSALREEINKSSHPSQPELNWKLVESLALAIFKAHGVDLHTATYYTLAR
TRTHGLAGFCEGVELLAAMISHDWDKFWPQDESARTGMLDWLNSRTGNILRQQLSFSGADLPLLYRTERA
LQLICDKLQQVELKRQPHVENLLYFVQNTRKRLEPPPKSSVDIPPQTTVRTLIYAPESTQPLTAENLPPL
PELPEMKVEVHHGAVEDPEPVARATSGRTIKGFMAGVVCAAAVAAALWWWQVYPMQQQLAQVRDTAQGAA
MLWLASPELDSYGQRLQQLPDASPLQLLEAGMQMMHTADSRWPESLQQQQATAQWNEILKTRAQSSPQMR
GWQQARQNLRDFADLMMQRETEKQGFTLSYIKTVTWQAERLLNQETPLESLLTQYQDARAQGRNAEVLEK
QINERLDGVLSRWLLLKNNVVPETATKAPPENNS
 
Nucleotide Sequence: 1365 bp     [Download]
>gi|198241740|ref|NC_011205.1|:c1208029-1206665 Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 chromosome, complete genome
ATGAGTCAGGACGCACTCACGCACATTATTGTTACCGGCCAGGATCCGCGCGGCCTGCCGGAGTTCAGCG
CCCTGCGGGAAGAGATCAACAAATCGTCTCACCCGTCGCAGCCGGAGCTGAACTGGAAACTGGTGGAATC
GCTGGCGCTGGCCATTTTTAAAGCCCATGGCGTGGATCTGCACACGGCCACTTATTACACCCTGGCGCGC
ACCCGCACGCACGGCCTGGCCGGATTTTGCGAAGGGGTGGAGCTACTGGCGGCCATGATAAGCCACGACT
GGGACAAATTCTGGCCGCAGGATGAGTCAGCCCGCACCGGGATGCTTGACTGGCTTAATTCGCGCACCGG
CAATATTCTGCGCCAGCAGCTGTCCTTCTCCGGCGCGGACCTGCCGTTGCTGTACCGCACCGAACGGGCG
TTACAGTTGATTTGCGACAAACTCCAGCAGGTGGAACTGAAACGCCAGCCGCATGTGGAGAACCTGCTTT
ATTTTGTGCAGAACACACGTAAGCGGCTTGAGCCGCCGCCGAAAAGCAGCGTGGACATTCCGCCGCAGAC
CACCGTCAGAACGTTGATCTACGCCCCGGAGAGCACGCAGCCCCTCACGGCGGAAAACCTTCCGCCCCTG
CCTGAGTTGCCGGAAATGAAGGTGGAAGTCCACCACGGCGCGGTGGAGGATCCAGAGCCTGTCGCCAGGG
CCACGTCAGGCCGGACTATAAAAGGCTTTATGGCCGGTGTCGTCTGCGCTGCGGCTGTCGCAGCCGCACT
CTGGTGGTGGCAGGTGTACCCGATGCAACAGCAACTGGCGCAGGTAAGGGACACGGCGCAGGGCGCGGCA
ATGCTCTGGCTGGCCTCGCCTGAACTGGACAGCTACGGGCAGCGGTTACAACAGCTTCCCGACGCCTCGC
CGCTGCAACTGCTGGAGGCGGGGATGCAGATGATGCATACCGCAGACAGCCGCTGGCCGGAGAGTCTGCA
ACAGCAGCAGGCAACAGCGCAGTGGAATGAAATCCTGAAAACCCGCGCGCAAAGCAGCCCACAAATGCGC
GGCTGGCAGCAGGCGCGCCAGAATCTGCGTGACTTTGCTGACCTGATGATGCAGCGGGAAACGGAGAAGC
AGGGCTTTACCCTCTCCTATATTAAAACGGTGACCTGGCAGGCGGAACGCCTGCTGAACCAGGAAACGCC
GCTGGAGTCCCTGCTGACGCAGTACCAAGATGCCCGCGCTCAGGGACGGAATGCGGAGGTGCTGGAAAAA
CAAATTAATGAACGGCTGGATGGGGTGTTAAGCCGCTGGCTGTTGCTGAAAAACAATGTAGTGCCGGAAA
CGGCAACTAAAGCCCCCCCCGAAAATAATAGTTAA