SecReT6
Protein ID: 206558743
SecReT6 ID292
T6SS typei4b
Gene symbol-
Locus tagBCAL0337
StrainBurkholderia cenocepacia J2315
Repliconchromosome I [GenBank: NC_011000] [Browse all T6SS(s) in this replicon]
Location [Strand]363015..363797 [-]
Productputative type VI secretion system protein TssL
NoteTssL
UniProt IDB4E6Q9
KEGG IDbcj:BCAL0337
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.40E-57, Aligned region: 30..231
Protein Sequence: 260 a.a.     [Download]
>gi|206558743|ref|YP_002229503.1| putative type VI secretion system protein TssL [Burkholderia cenocepacia J2315]
MSYAPSLFGDNAPAPLHTPASTDSAFQARSLLDLLYDGFFMLFLLKNGREPDSASEFSTRIQEFLSDFER
GAKKLNIAAEDVYGAKFAFCAAIDEMVLSSQFKIRADWERRPLQLVLFGEQLAGEKFFQYLEEGRAQGAA
RLQSLEVFHMCLLLGFQGKYLLEGPEKLAYLTARLGDEIAHMKGKRAPFAPHWPLPDQIAHRLKREVPVW
AIGTVFALVALLGYLGLNTYLKDKTLQALAPYSQVIKVGPESANLTISLP
 
Nucleotide Sequence: 783 bp     [Download]
>gi|206558403|ref|NC_011000.1|:c363797-363015 Burkholderia cenocepacia J2315 chromosome 1, complete sequence
ATGAGCTACGCGCCTTCCTTGTTCGGCGACAACGCGCCGGCACCGCTGCATACCCCGGCGTCGACGGACT
CCGCGTTCCAGGCCCGTTCGCTGCTCGATTTGCTGTACGACGGGTTCTTCATGCTGTTCCTGCTCAAGAA
CGGACGGGAGCCGGACAGCGCCAGCGAGTTCAGCACGCGGATCCAGGAATTCCTGTCGGATTTCGAGCGC
GGCGCGAAGAAGCTGAATATCGCCGCCGAGGACGTGTACGGCGCGAAGTTCGCGTTCTGCGCGGCCATCG
ACGAGATGGTGCTGTCGTCGCAGTTCAAGATCCGCGCGGACTGGGAACGCCGGCCGCTGCAGCTCGTGTT
GTTCGGCGAGCAGCTCGCCGGCGAGAAGTTCTTCCAGTATCTCGAGGAAGGTCGTGCGCAGGGTGCGGCA
CGGCTGCAGTCGCTCGAGGTGTTCCATATGTGCCTGCTGCTCGGGTTCCAGGGCAAGTACCTGCTCGAAG
GGCCGGAAAAGCTCGCGTACCTGACCGCGCGGCTGGGCGACGAGATCGCGCACATGAAGGGCAAGCGCGC
GCCGTTCGCGCCGCACTGGCCGCTGCCGGACCAGATCGCGCACCGCTTGAAGCGCGAGGTGCCGGTGTGG
GCGATCGGGACCGTGTTCGCGCTGGTGGCGCTGCTCGGGTACCTCGGGCTCAACACGTACCTGAAGGACA
AGACGCTGCAAGCGCTCGCGCCGTATTCGCAGGTGATCAAGGTCGGGCCGGAGTCGGCCAACCTGACGAT
CTCGTTGCCGTAA