SecReT6
Protein ID: 206558744
SecReT6 ID292
T6SS typei4b
Gene symbol-
Locus tagBCAL0338
StrainBurkholderia cenocepacia J2315
Repliconchromosome I [GenBank: NC_011000] [Browse all T6SS(s) in this replicon]
Location [Strand]363794..365140 [-]
Productputative type VI secretion system protein TssK
NoteTssK
UniProt IDB4E6R0
KEGG IDbcj:BCAL0338
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.50E-135, Aligned region: 19..446
Protein Sequence: 448 a.a.     [Download]
>gi|206558744|ref|YP_002229504.1| putative type VI secretion system protein TssK [Burkholderia cenocepacia J2315]
MSYSAKVLWGEGLFLRPQHFQRQDAYHEARLFESIQAIQPYNWGVRSVRIDRDALGSNVLRVAELALVFP
DGALYAAPQADDLPPPIALDTLPDGINEFVFYLALHPLRENGTNYSDDPAAGFMTRFVSEQTSVADNFTD
AAEADITFLKTQVKLIAHSEPRDQLLSVPLVRVRRTATSGFEIDDSFVPPCLAIEASPILHQRLRQLVDA
LQAKVNALYGFHREPSKNIIEFRSGDIASFWLLHTANAAFATLAHLHQHAALHPERLFQELLRLAGQLMT
FSKGYTLADLPVYRHDDPGPSFARLDLMLRELLDTVISTRYFAITLDEVRPSFHLGRLDSGKIDDKTEFY
LAVSADMPSVELVDAVPARFKVGAPDDVDKLVLSAMPGVRLSYTPQVPPAIPVRPGACYFALDSRSPLYE
RMLQAQSAMIYAPTGINDLKFELIAVTS
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|206558403|ref|NC_011000.1|:c365140-363794 Burkholderia cenocepacia J2315 chromosome 1, complete sequence
ATGAGTTATTCGGCCAAGGTGCTGTGGGGGGAAGGGCTGTTCCTCCGGCCTCAACACTTTCAGCGGCAGG
ACGCGTACCACGAGGCGCGCCTGTTCGAGTCCATCCAGGCGATCCAGCCATACAACTGGGGCGTGCGCTC
GGTGCGCATCGACCGCGACGCGCTCGGCAGCAACGTGCTGCGGGTGGCCGAACTCGCGCTCGTGTTCCCG
GACGGCGCGCTGTATGCCGCGCCGCAGGCCGACGACCTGCCGCCGCCGATCGCACTGGATACGTTGCCCG
ACGGCATCAACGAATTCGTGTTCTATCTCGCGCTGCACCCGCTGCGCGAGAACGGCACCAACTACAGCGA
CGATCCGGCCGCCGGCTTCATGACGCGGTTCGTCAGCGAGCAGACGAGCGTCGCCGACAACTTCACCGAC
GCCGCCGAAGCCGACATCACGTTCCTGAAGACGCAGGTCAAGCTGATCGCGCACAGCGAGCCGCGCGACC
AGCTGCTGTCGGTGCCGCTCGTACGCGTGCGCCGCACCGCGACGTCCGGCTTCGAGATCGACGACAGCTT
CGTGCCGCCGTGCCTCGCGATCGAAGCGTCGCCGATCCTGCACCAGCGGCTGCGCCAGCTGGTCGACGCG
CTGCAGGCGAAGGTGAACGCGCTGTACGGCTTTCACCGCGAGCCGTCGAAGAACATCATCGAGTTCCGCT
CGGGCGACATCGCGTCGTTCTGGCTGCTGCACACGGCGAACGCCGCATTCGCGACGCTCGCGCACCTGCA
CCAGCATGCGGCGCTGCATCCGGAGCGGCTGTTCCAGGAGCTGCTGCGCCTCGCCGGCCAGTTGATGACG
TTCTCGAAGGGCTATACGCTCGCCGACCTGCCCGTGTACCGCCACGACGATCCGGGCCCGAGCTTCGCGC
GTCTCGACCTGATGCTGCGCGAACTGCTCGACACCGTGATCTCGACGCGCTATTTCGCGATCACGCTCGA
CGAGGTGCGCCCGTCGTTCCACCTCGGCCGCCTCGATTCCGGCAAGATCGACGACAAGACCGAGTTCTAC
CTCGCAGTGTCCGCGGACATGCCGAGCGTCGAGCTCGTCGATGCGGTGCCGGCCCGCTTCAAGGTCGGCG
CGCCGGACGACGTCGACAAGCTCGTGCTGTCGGCGATGCCCGGCGTGCGGCTGTCGTACACGCCGCAGGT
GCCGCCCGCGATTCCGGTGCGCCCCGGCGCGTGCTACTTCGCGCTCGATTCGCGCAGCCCGCTGTACGAG
CGCATGCTGCAGGCCCAGTCCGCGATGATCTACGCGCCGACTGGCATCAATGACCTGAAATTCGAACTGA
TCGCGGTCACATCATGA