SecReT6
Protein ID: 206558745
SecReT6 ID292
T6SS typei4b
Gene symbol-
Locus tagBCAL0339
StrainBurkholderia cenocepacia J2315
Repliconchromosome I [GenBank: NC_011000] [Browse all T6SS(s) in this replicon]
Location [Strand]365246..365845 [-]
Productputative type VI secretion system protein TssJ
NoteTssJ
UniProt IDB4E6R1
KEGG IDbcj:BCAL0339
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 7.80E-38, Aligned region: 11..171
Protein Sequence: 199 a.a.     [Download]
>gi|206558745|ref|YP_002229505.1| putative type VI secretion system protein TssJ [Burkholderia cenocepacia J2315]
MIRYALPLLACALLAGCAAAPLLGSAASAVMSAAGIGKPEVPDAQKPPRNIGLTLAAAPNLNAATDNKPL
ALVVRLYALKDPTSFQQAPFDAFTDPAKEKTALGADLLNVREITLIPGQRYTATEKVSREAQAFGIVALF
RDPALQRWKLTFDPVKSEKSGIIIGLHNCAMTVTDGTVIAPQQGAPSQPLNMLSSVSCG
 
Nucleotide Sequence: 600 bp     [Download]
>gi|206558403|ref|NC_011000.1|:c365845-365246 Burkholderia cenocepacia J2315 chromosome 1, complete sequence
ATGATTCGCTACGCGCTGCCGCTGCTTGCGTGCGCCCTTCTGGCCGGATGCGCGGCCGCTCCGCTGCTCG
GCTCGGCCGCGAGCGCCGTGATGTCCGCGGCCGGCATCGGCAAGCCCGAGGTGCCCGACGCGCAGAAGCC
GCCGCGCAACATAGGCCTCACGCTGGCCGCCGCACCGAACCTGAATGCCGCGACCGACAACAAGCCGCTT
GCGCTCGTCGTGCGCCTCTATGCGCTGAAAGACCCGACCTCGTTCCAGCAAGCGCCGTTCGACGCATTTA
CCGACCCGGCCAAGGAAAAAACCGCACTCGGCGCCGATCTGCTGAACGTGCGTGAAATCACGCTGATTCC
GGGCCAGCGCTATACGGCAACCGAGAAGGTATCGCGCGAAGCGCAGGCATTCGGCATTGTCGCGCTGTTC
CGCGATCCCGCACTGCAACGCTGGAAACTGACGTTCGATCCGGTGAAGTCGGAGAAATCCGGCATAATCA
TCGGCCTGCATAATTGCGCGATGACGGTCACCGACGGCACGGTCATCGCACCGCAACAGGGTGCGCCTTC
GCAACCGCTGAATATGCTGTCTTCGGTCTCCTGCGGTTAA