SecReT6
Protein ID: 206558747
SecReT6 ID292
T6SS typei4b
Gene symbol-
Locus tagBCAL0341
StrainBurkholderia cenocepacia J2315
Repliconchromosome I [GenBank: NC_011000] [Browse all T6SS(s) in this replicon]
Location [Strand]366905..367420 [+]
Productputative type VI secretion system protein TssB
NoteTssB
UniProt IDB4E6R3
KEGG IDbcj:BCAL0341
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.60E-59, Aligned region: 11..163
Protein Sequence: 171 a.a.     [Download]
>gi|206558747|ref|YP_002229507.1| putative type VI secretion system protein TssB [Burkholderia cenocepacia J2315]
MAKKESIQKSLQKIRPPRVQLTYEVEKGDAIEVKELPFVVGVVGDLAGQSEIEQPKLRDRKFVNIDRDNF
DDVMKAIEPRAAFQVENRLSPEGGKFAVDLKFRSLSDFSPDEVVEQVEPLRRLLEARSKLADLRNKLAGN
DKLEDLLSEVLKNTQQLQELAKGTGGDKDGE
 
Nucleotide Sequence: 516 bp     [Download]
>gi|206558403|ref|NC_011000.1|:366905-367420 Burkholderia cenocepacia J2315 chromosome 1, complete sequence
ATGGCCAAGAAAGAAAGCATTCAGAAAAGCTTGCAGAAAATACGGCCGCCGCGCGTCCAGCTGACCTACG
AGGTCGAGAAGGGCGATGCGATCGAGGTGAAGGAACTGCCGTTCGTCGTCGGGGTCGTCGGCGATCTGGC
GGGCCAGTCCGAAATCGAGCAGCCGAAGCTGCGCGACCGCAAGTTCGTCAATATCGACCGCGACAATTTC
GACGACGTGATGAAGGCGATCGAGCCGCGCGCCGCGTTCCAGGTGGAAAACCGCCTGAGCCCGGAAGGCG
GCAAGTTCGCGGTCGACCTGAAGTTCCGCTCGCTGTCGGATTTCAGCCCGGACGAAGTCGTCGAACAGGT
CGAGCCGCTGCGCCGCCTGCTCGAGGCGCGCTCGAAGCTCGCCGACCTGCGCAACAAGCTCGCCGGCAAC
GACAAGCTCGAGGATCTGCTGTCCGAGGTGCTGAAGAACACGCAGCAGCTGCAGGAGCTCGCGAAGGGCA
CCGGCGGCGACAAAGACGGCGAATGA