SecReT6
Protein ID: 206558748
SecReT6 ID292
T6SS typei4b
Gene symbol-
Locus tagBCAL0342
StrainBurkholderia cenocepacia J2315
Repliconchromosome I [GenBank: NC_011000] [Browse all T6SS(s) in this replicon]
Location [Strand]367436..368926 [+]
Productputative type VI secretion system protein TssC
NoteTssC
UniProt IDB4E6R4
KEGG IDbcj:BCAL0342
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.20E-191, Aligned region: 67..491
Protein Sequence: 496 a.a.     [Download]
>gi|206558748|ref|YP_002229508.1| putative type VI secretion system protein TssC [Burkholderia cenocepacia J2315]
MNQQTAAAQASGAEYAAGTSLLDDIVEKSKVAKSDSEHARAKDLIGELVHQVLDGTVIVSDNLSATIDAR
VAELDRLISTQLSAVMHAPEFQRLESTWRGLDYLVKESNTGQTIKIKALHAPKRDLVRDFKGASEFDQSA
LFKKVYEEEFGTFGGSPFGALIGDYEISRQPEDMYFIEQMSHVAAAAHAPFIASASPELLGLESFSDLGK
PRDLGKVFDTVEYAKWKSFRDAEDSRYVGLTLPRFLGRLPFNPKDGQTAENFNFVEDVDGTDHDKYLWCN
AAWAFAARLTAAFDDFGWCAAIRGVEGGGLVEDLPTHTFKTDDGEVALKCPTEIAITDRREKELSDLGFI
PLVHCKNSDYAAFFAAQSVQKPKKYSTDSANANAVLSAQLQYIFSVSRVAHYLKAMMRDKIGSFASAQNV
ETFLNRWISQYVLLDDNASQEQKAQFPLREASIQVSEIPGKPGSYRSVAFLRPHFQLDELSISLRLVADL
PKPANS
 
Nucleotide Sequence: 1491 bp     [Download]
>gi|206558403|ref|NC_011000.1|:367436-368926 Burkholderia cenocepacia J2315 chromosome 1, complete sequence
ATGAACCAGCAAACGGCTGCGGCCCAAGCGAGCGGCGCGGAATACGCCGCCGGGACTTCGTTGCTCGACG
ACATCGTCGAGAAGAGCAAGGTCGCGAAATCCGATTCCGAGCATGCGCGCGCGAAGGACCTGATCGGCGA
ACTCGTGCACCAGGTGCTCGACGGCACGGTGATCGTGTCGGACAACCTGTCGGCCACGATCGATGCGCGC
GTCGCGGAACTCGACCGCCTGATTTCCACGCAGCTTTCCGCGGTGATGCACGCGCCGGAATTCCAGCGCC
TCGAAAGCACGTGGCGCGGGCTGGACTATCTGGTCAAGGAAAGCAACACGGGCCAGACGATCAAGATCAA
GGCGCTGCACGCACCGAAGCGCGACCTCGTGCGCGATTTCAAGGGCGCGAGCGAGTTCGACCAGAGCGCG
CTGTTCAAGAAGGTCTACGAAGAGGAATTCGGCACGTTCGGCGGTTCGCCGTTCGGTGCGCTGATCGGCG
ATTACGAGATCTCGCGCCAGCCGGAAGACATGTATTTCATCGAGCAGATGTCGCACGTCGCGGCGGCCGC
GCATGCGCCGTTCATCGCGTCGGCGTCGCCGGAGCTGCTCGGCCTCGAGTCGTTCTCCGACCTCGGCAAG
CCGCGCGACCTCGGCAAGGTGTTCGACACCGTCGAATACGCGAAGTGGAAATCGTTCCGCGACGCCGAGG
ATTCCCGCTACGTCGGCCTGACGCTGCCGCGCTTCCTCGGCCGCCTGCCGTTCAATCCGAAGGACGGCCA
GACCGCGGAGAACTTCAACTTCGTCGAGGACGTCGACGGCACCGACCACGACAAGTACCTGTGGTGCAAC
GCGGCATGGGCCTTCGCGGCACGCCTGACGGCCGCGTTCGACGACTTCGGCTGGTGCGCGGCGATCCGCG
GCGTCGAAGGCGGTGGCCTCGTCGAGGATCTGCCGACCCACACGTTCAAGACCGACGACGGTGAAGTCGC
GCTGAAGTGCCCGACCGAAATCGCGATCACCGATCGCCGCGAGAAGGAGCTGAGCGACCTCGGCTTCATC
CCGCTCGTCCATTGCAAGAACTCAGATTACGCCGCGTTCTTCGCTGCGCAGTCGGTGCAGAAGCCGAAAA
AGTACAGCACCGACAGCGCGAATGCGAACGCCGTCCTGTCCGCCCAGCTTCAGTACATCTTCTCGGTATC
GCGCGTCGCGCACTACCTGAAGGCGATGATGCGGGACAAGATCGGCAGCTTCGCATCGGCGCAGAACGTG
GAGACTTTCCTCAACCGGTGGATTTCGCAGTACGTCCTGCTCGACGACAACGCCTCGCAGGAACAGAAAG
CGCAATTCCCGCTGCGCGAGGCATCCATACAAGTGTCGGAGATTCCGGGCAAGCCGGGCTCGTATCGTTC
GGTCGCGTTCCTGCGTCCGCACTTTCAGCTCGACGAACTCTCGATTTCTCTGCGACTTGTCGCTGATCTG
CCCAAACCGGCAAATTCATAA