SecReT6
Protein ID: 206558749
SecReT6 ID292
T6SS typei4b
Gene symbol-
Locus tagBCAL0343
StrainBurkholderia cenocepacia J2315
Repliconchromosome I [GenBank: NC_011000] [Browse all T6SS(s) in this replicon]
Location [Strand]368997..369500 [+]
Productputative type VI secretion system protein TssD
NoteTssD
UniProt IDB4E6R5
KEGG IDbcj:BCAL0343
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 6.70E-43, Aligned region: 7..139
Protein Sequence: 167 a.a.     [Download]
>gi|206558749|ref|YP_002229509.1| putative type VI secretion system protein TssD [Burkholderia cenocepacia J2315]
MLHMHLQFGSPAVKGESADKDHQGWIELKSWDHSIVQPRSATASTAGGHTMTRCEHGDMIFTKEIDSSSP
LLYQHASGGTTFDEVTVHFSRADGEGKRVQYLEVKLKYVIISSIAPSVREEGLPLETFSLKYAAVQWKQT
QQKIGGNQGGNTQGAWSLTKNDKTYAV
 
Nucleotide Sequence: 504 bp     [Download]
>gi|206558403|ref|NC_011000.1|:368997-369500 Burkholderia cenocepacia J2315 chromosome 1, complete sequence
ATGTTACATATGCACTTGCAGTTTGGTAGTCCCGCGGTGAAGGGCGAATCCGCGGACAAGGACCATCAGG
GCTGGATCGAACTGAAATCGTGGGATCACTCGATCGTTCAGCCGCGTTCGGCAACCGCATCGACCGCTGG
CGGTCACACGATGACGCGTTGCGAGCACGGCGACATGATCTTCACGAAGGAAATCGATTCGTCGAGCCCG
CTGCTGTACCAGCACGCTTCGGGCGGTACCACGTTCGACGAAGTGACGGTCCATTTCTCGCGCGCGGACG
GTGAAGGCAAGCGCGTGCAGTATCTGGAAGTCAAGCTCAAATACGTGATCATCTCGAGCATCGCCCCGAG
CGTCCGCGAGGAAGGTCTGCCCCTCGAGACGTTCTCGCTGAAGTACGCAGCCGTGCAGTGGAAGCAAACC
CAGCAGAAGATCGGCGGCAACCAGGGCGGCAACACGCAAGGCGCCTGGAGCCTGACGAAGAACGACAAGA
CCTACGCGGTCTAA