SecReT6
Protein ID: 206558750
SecReT6 ID292
T6SS typei4b
Gene symbol-
Locus tagBCAL0344
StrainBurkholderia cenocepacia J2315
Repliconchromosome I [GenBank: NC_011000] [Browse all T6SS(s) in this replicon]
Location [Strand]369563..370048 [+]
Productputative type VI secretion system protein TssE
NoteTssE
UniProt IDB4E6R6
KEGG IDbcj:BCAL0344
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.70E-22, Aligned region: 29..137
Protein Sequence: 161 a.a.     [Download]
>gi|206558750|ref|YP_002229510.1| putative type VI secretion system protein TssE [Burkholderia cenocepacia J2315]
MKRFEPSFLDKLFDDEPHLPASAAMRQLSLDELKNTVARDVEAILNTRIAHTENELAALPECQKSVLTYG
LNDFAGLSLASHYDRAFICKSIQQAIARHEPRLQQVQVTFELNEQATNALYFAIQALLVVHPAEEPVSFD
AMLQPSTLQYSVTRARAARMQ
 
Nucleotide Sequence: 486 bp     [Download]
>gi|206558403|ref|NC_011000.1|:369563-370048 Burkholderia cenocepacia J2315 chromosome 1, complete sequence
ATGAAACGATTCGAACCCAGTTTTCTCGACAAGCTGTTCGACGACGAACCGCATCTGCCGGCCTCGGCCG
CGATGCGGCAATTGTCGCTGGACGAGCTCAAGAACACGGTCGCCCGCGACGTCGAGGCGATCCTCAACAC
CCGTATCGCGCATACCGAGAACGAGCTGGCCGCGCTGCCGGAATGCCAGAAATCGGTGCTGACCTACGGG
CTGAACGATTTCGCGGGGCTGAGCCTCGCGAGCCACTACGACCGCGCATTCATCTGCAAGTCGATCCAGC
AGGCCATCGCGCGCCACGAGCCGCGCCTGCAGCAGGTGCAGGTGACGTTCGAGCTGAACGAGCAGGCCAC
CAACGCGCTGTACTTCGCGATCCAGGCGCTGCTCGTCGTGCACCCGGCCGAGGAGCCGGTGAGTTTCGAC
GCGATGCTGCAACCGTCGACGCTGCAGTATTCGGTCACGCGCGCACGCGCGGCACGCATGCAGTAA