SecReT6
Protein ID: 206558751
SecReT6 ID292
T6SS typei4b
Gene symbol-
Locus tagBCAL0345
StrainBurkholderia cenocepacia J2315
Repliconchromosome I [GenBank: NC_011000] [Browse all T6SS(s) in this replicon]
Location [Strand]370125..371960 [+]
Productputative type VI secretion system protein TssF
NoteTssF
UniProt IDB4E6R7
KEGG IDbcj:BCAL0345
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 4.20E-216, Aligned region: 4..610
Protein Sequence: 611 a.a.     [Download]
>gi|206558751|ref|YP_002229511.1| putative type VI secretion system protein TssF [Burkholderia cenocepacia J2315]
MEELLPYYERELSFLRRYSRDFAERYPKIAARLALSGEHCEDPHVERMIESFALLGARINKKLDDDYPEF
TEALLEVLYPHYLRPFPSCSIAQFTPASPGQQTEPVVIERGTELKSRPIRGVQCRFRTAYDVTLAPIRIS
EARYTPVALAPSATVLPSNATGVISITFESLAAQLDLGALKLSTLRAHLHGEQSFVAALTDCLFVNVLGA
YVEPERNGRWTALRKLPIAQAGFAEDDALIDYPAKSHPAYRLLTEYFAFPDKFDFVDFDLAAIARASGRC
QRATLHLVLQDVRSDSHVARLLELLMASHFRLFCTPIVNLFRQHGEPIRITHRAVSYPVIAEARRAFAYE
VYSIDSVKLVRQQAHEESVIEFRPFYSLHHGEAARIGHYWFARRNDWVAQKSPGYETEISIVDIDFEPTS
PQTDTLSLDLTCTNRDLPAMLAFGLEGGDLFQEGGAQTSGISLLRRPTQSVRFERGRAAHWRLVSHLALN
HVSLVAHGLAPLKEMLTLYDLRRTAVSMRQIDGLVGVEQRGAVQWLPGKPFATFVRGIEIRLTIDEEHFV
GASLASFVRVLDSFFGLYVHLNSFVQLVVVSKRTGEEIIRCKPRTGESILA
 
Nucleotide Sequence: 1836 bp     [Download]
>gi|206558403|ref|NC_011000.1|:370125-371960 Burkholderia cenocepacia J2315 chromosome 1, complete sequence
ATGGAAGAATTGCTGCCGTATTACGAACGCGAATTATCGTTTTTGCGGCGCTATTCGCGAGATTTCGCCG
AACGCTATCCGAAGATCGCCGCGCGCCTCGCGCTGTCCGGCGAGCATTGCGAGGATCCGCACGTCGAGCG
GATGATCGAGTCGTTCGCGCTGCTCGGCGCGCGCATCAACAAGAAGCTCGACGACGACTACCCCGAATTC
ACCGAAGCGCTGCTGGAAGTGCTGTATCCGCACTACCTGCGGCCGTTCCCGTCGTGTTCGATCGCGCAGT
TCACGCCGGCTTCGCCCGGCCAGCAGACCGAACCGGTCGTGATCGAGCGCGGCACCGAGCTGAAGAGCCG
TCCGATCCGCGGCGTGCAATGCCGGTTCCGTACCGCCTACGACGTGACGCTCGCGCCGATCCGCATCTCG
GAAGCACGCTATACGCCGGTCGCGCTCGCGCCGAGCGCGACGGTGCTGCCGTCGAACGCGACGGGCGTGA
TCTCGATCACGTTCGAATCGCTCGCCGCGCAGCTCGATCTCGGCGCGCTGAAGCTGTCGACGCTGCGCGC
GCACCTGCACGGCGAGCAGTCGTTCGTCGCCGCGCTCACCGACTGCCTGTTCGTCAACGTGCTCGGCGCG
TACGTCGAGCCCGAACGCAACGGCCGCTGGACCGCGCTGCGCAAGCTGCCGATCGCGCAGGCCGGCTTCG
CCGAGGACGACGCGCTGATCGACTATCCGGCGAAATCGCATCCCGCATACCGGCTGCTCACCGAATACTT
CGCGTTCCCCGACAAGTTCGATTTCGTCGACTTCGACCTCGCGGCGATCGCGCGCGCGTCGGGCCGCTGC
CAGCGCGCGACGCTGCATCTGGTGCTGCAGGACGTGCGCAGCGATTCGCACGTCGCGCGCCTGCTCGAAT
TGCTGATGGCGAGCCATTTCCGGCTGTTCTGCACGCCGATCGTGAACCTGTTCCGCCAGCACGGCGAGCC
GATCCGCATCACGCACCGCGCGGTGTCGTATCCGGTGATCGCCGAGGCGCGGCGCGCGTTCGCGTACGAG
GTGTACTCGATCGACTCGGTGAAGCTCGTCCGGCAGCAGGCGCACGAGGAATCGGTGATCGAGTTCCGGC
CGTTCTATTCGCTGCATCACGGCGAAGCGGCGCGGATCGGCCACTACTGGTTCGCGCGGCGCAACGACTG
GGTCGCACAGAAGAGCCCCGGCTACGAAACCGAGATCTCGATCGTCGACATCGACTTCGAGCCGACGTCG
CCGCAGACCGACACGCTGAGCCTCGATCTCACCTGCACGAACCGCGACCTGCCTGCCATGCTGGCGTTCG
GCCTCGAAGGCGGCGACCTGTTCCAGGAAGGCGGCGCGCAGACGAGCGGCATTTCGCTGCTGCGTCGCCC
GACGCAGAGCGTGCGCTTCGAGCGCGGCCGCGCCGCGCACTGGCGGCTCGTGTCGCACCTCGCGCTCAAC
CACGTATCGCTCGTCGCGCACGGCCTCGCACCGCTGAAGGAAATGCTGACGCTGTACGACCTGCGACGCA
CGGCGGTGTCGATGCGCCAGATCGACGGCCTGGTCGGCGTCGAGCAGCGCGGCGCCGTGCAGTGGCTGCC
CGGCAAGCCGTTCGCGACCTTCGTGCGCGGCATCGAGATCCGGCTGACGATCGACGAGGAACACTTCGTC
GGCGCGAGCCTCGCGTCCTTCGTGCGCGTGCTCGACAGCTTCTTCGGGCTGTACGTCCACCTCAACAGTT
TCGTTCAATTGGTCGTCGTGTCGAAGCGCACCGGCGAGGAGATCATTCGATGCAAGCCCCGAACCGGCGA
ATCGATCCTGGCGTAG