SecReT6
Protein ID: 206558752
SecReT6 ID292
T6SS typei4b
Gene symbol-
Locus tagBCAL0346
StrainBurkholderia cenocepacia J2315
Repliconchromosome I [GenBank: NC_011000] [Browse all T6SS(s) in this replicon]
Location [Strand]371924..373024 [+]
Productputative type VI secretion system protein TssG
NoteTssG
UniProt IDB4E6R8
KEGG IDbcj:BCAL0346
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.60E-94, Aligned region: 18..347
Protein Sequence: 366 a.a.     [Download]
>gi|206558752|ref|YP_002229512.1| putative type VI secretion system protein TssG [Burkholderia cenocepacia J2315]
MQAPNRRIDPGVVDALLDEPHRFEFFQAVRVLEGLFARQASDAPGAWRQGDVVAQRIAFRNTLSLGFPPS
EIEGARSFDDDGASLSSDEQRGAALAAGELGRVELTPAFFGLLGGQGALPLHYTEQIVAREHLRRDHAAR
AFFDVFSNRATALFYAAWKKYRLPFHYELDRDERYLPLLLAIAGVPSDEVRDSLAAGAGGVLDEAVAGYA
LAARHRPMSAAYLQRTLSDYFRVPVKIDQFVGKWYDVPPDQLSVLGEVNAVLGATALVGERVWQRDMRAR
IVVGPLSKRDYEAFLPGGAQAVALERMLTLLAGVTLEYEVKLVLKRTEVGASVLGAGSRLGWDAFLCTRD
AAEDRSDARYELHVIH
 
Nucleotide Sequence: 1101 bp     [Download]
>gi|206558403|ref|NC_011000.1|:371924-373024 Burkholderia cenocepacia J2315 chromosome 1, complete sequence
ATGCAAGCCCCGAACCGGCGAATCGATCCTGGCGTAGTCGACGCGCTGCTCGACGAGCCGCACCGCTTCG
AGTTCTTCCAGGCGGTGCGCGTGCTCGAGGGGCTGTTCGCGCGGCAGGCGTCGGATGCGCCCGGCGCATG
GCGGCAGGGCGACGTGGTCGCGCAGCGCATCGCATTCCGCAACACGCTGTCGCTCGGCTTTCCGCCGAGC
GAGATCGAAGGCGCGCGCTCGTTCGACGACGACGGCGCGTCGCTGAGTTCGGACGAGCAGCGCGGCGCCG
CGCTGGCCGCCGGCGAGCTCGGCCGCGTCGAGCTGACGCCCGCGTTCTTCGGGCTGCTCGGCGGGCAAGG
CGCGCTGCCGCTGCACTACACCGAGCAGATCGTCGCGCGCGAGCATCTGCGGCGCGACCATGCGGCGCGC
GCGTTCTTCGACGTGTTCTCGAACCGCGCGACCGCGCTGTTCTACGCGGCGTGGAAGAAATACCGGCTGC
CGTTCCACTACGAGCTCGACCGCGACGAGCGCTACCTGCCGCTGTTGCTCGCGATCGCGGGCGTGCCGAG
CGACGAGGTGCGCGACAGCCTCGCGGCCGGCGCGGGCGGTGTGCTCGACGAGGCCGTGGCCGGCTACGCG
CTCGCCGCGCGGCACCGGCCGATGTCGGCCGCCTACCTGCAGCGCACGCTGTCCGATTACTTCCGCGTGC
CGGTGAAGATCGACCAGTTCGTCGGCAAGTGGTACGACGTGCCGCCCGATCAGCTGAGCGTGCTCGGTGA
AGTCAACGCGGTGCTCGGCGCGACGGCGCTCGTCGGCGAGCGCGTGTGGCAGCGCGACATGCGCGCGCGA
ATCGTCGTCGGCCCGCTGTCCAAGCGCGACTACGAGGCGTTCCTGCCCGGCGGCGCGCAGGCCGTCGCGC
TCGAGCGGATGCTGACGCTGCTCGCCGGCGTCACGCTCGAATACGAGGTGAAGCTCGTGCTGAAGCGCAC
CGAGGTCGGCGCGAGCGTGCTCGGCGCGGGCTCGCGGCTCGGCTGGGATGCGTTCCTGTGCACGCGCGAC
GCGGCCGAGGACCGTTCGGACGCCCGCTACGAACTGCACGTGATTCACTGA