SecReT6
Protein ID: 206558754
SecReT6 ID292
T6SS typei4b
Gene symbol-
Locus tagBCAL0348
StrainBurkholderia cenocepacia J2315
Repliconchromosome I [GenBank: NC_011000] [Browse all T6SS(s) in this replicon]
Location [Strand]375780..376901 [+]
Productputative type VI secretion system protein TssA
NoteTssA
UniProt IDB4E6S0
KEGG IDbcj:BCAL0348
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 6.60E-24, Aligned region: 55..116
Protein Sequence: 373 a.a.     [Download]
>gi|206558754|ref|YP_002229514.1| putative type VI secretion system protein TssA [Burkholderia cenocepacia J2315]
MPINLPELLTPISEASPSGDDLLFSNEFDAIQDARRYDDPTLDQGEWVTEIKEADWGFVVDHAGELLRTR
TKDLRLAVWLTEALALEDGITGLTEGYALLEGLCREFWDTFHPLPEDDDIEHRLGNVAWLSGRTAELLRA
VPLTDGASNAFSTLDWEVAQHVAQSIKRDPEHADDIARGKPSIEQIDASRRVTSIAFYTALLANLKAFEF
ALDAFEERLVERAGDSAPSFRQARDAFETVYRLAERFAREQGYTGSAPHTQAVQQAQPERIEPVFGQPIQ
TEETHVQQQTASRPPVTQTIAGIQNRAQAVDQLRAVARYFRQTEPHSPVAYLADKAAEWADMPLHKWLES
VVKDDGSLSHIRELLGVRPDEQS
 
Nucleotide Sequence: 1122 bp     [Download]
>gi|206558403|ref|NC_011000.1|:375780-376901 Burkholderia cenocepacia J2315 chromosome 1, complete sequence
ATGCCGATCAATCTCCCCGAGCTGCTGACGCCGATCAGCGAGGCGTCGCCCAGCGGCGACGACCTGCTGT
TCTCGAACGAATTCGACGCGATCCAGGACGCGCGGCGCTACGACGACCCGACGCTCGACCAGGGCGAATG
GGTGACCGAGATCAAGGAGGCCGACTGGGGCTTCGTCGTCGACCATGCGGGCGAGCTGCTGCGCACGCGC
ACGAAGGACCTGCGGCTCGCCGTGTGGCTGACCGAGGCGCTCGCGCTCGAGGACGGCATCACCGGCCTCA
CCGAAGGCTATGCGCTGCTCGAGGGTCTGTGCCGCGAGTTCTGGGACACCTTCCACCCGCTGCCCGAGGA
CGACGACATCGAGCACCGGCTCGGCAACGTCGCATGGCTGTCCGGTCGCACGGCCGAGCTGCTGCGCGCG
GTGCCGCTGACCGACGGTGCATCGAATGCGTTCAGCACGCTCGACTGGGAAGTCGCGCAGCACGTCGCGC
AGTCGATCAAGCGCGACCCCGAGCATGCGGACGACATCGCGCGCGGCAAGCCGTCGATCGAGCAGATCGA
CGCGTCGCGGCGCGTGACGTCGATCGCGTTCTACACGGCGCTGCTGGCGAACCTGAAGGCGTTCGAATTC
GCGCTCGATGCGTTCGAGGAGCGGCTCGTCGAGCGCGCGGGCGATTCGGCGCCGAGCTTCCGGCAGGCGC
GCGACGCGTTCGAGACCGTGTACCGGCTCGCCGAGCGCTTCGCGCGCGAACAGGGCTATACCGGCAGCGC
GCCGCACACGCAGGCGGTGCAGCAGGCCCAGCCCGAGCGCATCGAGCCGGTGTTCGGCCAACCGATCCAG
ACCGAGGAGACCCACGTGCAGCAGCAGACCGCTTCGCGTCCTCCGGTGACGCAGACGATCGCCGGCATCC
AGAACCGTGCGCAGGCCGTCGACCAGTTGCGTGCGGTGGCGCGCTATTTCCGTCAGACCGAGCCGCACAG
CCCAGTCGCGTATCTCGCCGACAAAGCGGCCGAATGGGCCGACATGCCGCTGCACAAGTGGCTCGAGAGC
GTCGTGAAGGACGACGGCTCGCTGTCGCATATTCGCGAACTGCTGGGCGTGCGGCCCGACGAGCAGTCGT
AA