SecReT6
Protein ID: 206577037
SecReT6 ID304
T6SS typeN/A
Gene symbolvasA
Locus tagKPK_0938
StrainKlebsiella pneumoniae 342
Repliconchromosome [GenBank: NC_011283] [Browse all T6SS(s) in this replicon]
Location [Strand]944583..946343 [-]
Producttype VI secretion protein
NoteTssF
UniProt IDB5XUW1
KEGG IDkpe:KPK_0938
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.40E-179, Aligned region: 6..583
Protein Sequence: 586 a.a.     [Download]
>gi|206577037|ref|YP_002236810.1| vasA gene product [Klebsiella pneumoniae 342]
MDDLTQRYYEAEMRYLREAGKEFAQAYPDRAAMLNLDKPGARDPYVERLFEGFAFLMGRLREKLDDDLPE
LTEGLVSLLWPHYLRTIPSLSVVELLTDHRQMKQSETLSDFQVLSRPVGEHRTRCCYSATRVITLLPLAL
PEVSLQYEQDGRSVIRLRFECSPLAGDGSQIDLSRLPLYLNADSPLACALHRALTLGVQQIWFRLPGEER
RTLDGYFSPMGFGKDDPLWPKGESAFSGYQLLLEYFTFREKFMFVALNGLENVVWPAGMSGFEIDVVLAE
SWSHDLPFSTENIRLHCVPVINLFPLEADPLHLSPLENEYLLRPMRIQDGHTEIYSVDNIISSRHTGSQA
YVPFSSFRHRGGMLRHDSPERYYHTRVKRGPSGLHDTWLILGGDAFDIDRLLEDETLSLSLTGTNGQLPR
KALQSTVLDTPVYATQHTLRVRNLCAPTQPCYPPARDRFHWRVLSHLGSNFLSMMDNAEILRGTLALYDW
TESEMNRRRLEAIVDVQHHLIQRFEKGFLLRGVDIQVTLDSNGFAGEGDITLFGELLHRFFALYADIHLF
TQLTLILQPTGKCLQWTEHHSQRVPG
 
Nucleotide Sequence: 1761 bp     [Download]
>gi|206575712|ref|NC_011283.1|:c946343-944583 Klebsiella pneumoniae 342 chromosome, complete genome
ATGGATGATTTAACCCAACGCTATTACGAAGCCGAAATGCGCTACCTGCGTGAAGCGGGTAAAGAGTTTG
CGCAAGCGTATCCTGATCGCGCCGCTATGCTCAATCTCGATAAGCCCGGCGCGCGCGACCCTTATGTCGA
ACGTCTCTTCGAAGGTTTCGCCTTCCTGATGGGCCGCCTGCGGGAAAAACTGGATGACGATCTACCTGAA
CTGACTGAGGGGCTGGTGAGCCTCCTGTGGCCTCATTATCTGCGTACAATCCCGTCGCTGTCGGTGGTGG
AACTGTTAACCGATCATCGGCAAATGAAGCAGAGCGAAACACTGAGTGATTTTCAGGTGCTCTCGAGGCC
GGTCGGCGAACACCGGACACGTTGCTGCTACAGCGCCACGCGGGTTATCACCCTGCTTCCGCTGGCTTTA
CCAGAGGTGTCGTTACAGTACGAACAGGATGGACGTTCGGTTATCCGTCTGCGCTTTGAGTGCAGCCCGC
TGGCTGGCGACGGGTCACAGATTGATTTATCGAGACTGCCGCTCTATCTCAATGCGGACAGTCCGCTGGC
TTGTGCATTACACCGGGCGCTGACGCTGGGGGTGCAGCAAATCTGGTTTCGCCTGCCGGGGGAGGAACGT
CGGACACTGGACGGCTATTTTTCCCCGATGGGGTTCGGTAAGGACGATCCGCTCTGGCCAAAAGGCGAAT
CGGCCTTCAGCGGCTACCAACTGCTGCTGGAGTATTTCACCTTCCGCGAGAAGTTTATGTTTGTCGCCCT
TAACGGGCTGGAGAATGTGGTCTGGCCGGCAGGAATGAGTGGATTCGAAATTGACGTGGTGCTCGCGGAA
AGCTGGTCTCACGATCTGCCGTTCAGCACCGAAAATATCCGCCTGCACTGCGTACCGGTGATCAACCTGT
TCCCGCTGGAAGCCGATCCACTGCATCTTTCTCCGCTGGAAAATGAATACTTGCTGCGCCCCATGCGTAT
TCAGGACGGGCATACGGAAATTTACTCCGTCGATAATATTATTTCTTCGCGACACACCGGCAGTCAGGCA
TATGTGCCCTTTTCCAGTTTTCGCCACCGGGGCGGGATGTTGCGTCACGATTCGCCGGAACGTTATTACC
ATACGCGGGTAAAACGCGGCCCTTCCGGTTTGCATGATACCTGGCTGATCCTTGGGGGCGACGCATTCGA
TATCGACCGCCTGCTGGAAGACGAAACCCTGTCCCTGAGTCTGACCGGAACCAACGGTCAGCTTCCGCGT
AAAGCGCTGCAGAGCACGGTGCTGGACACCCCCGTCTACGCCACGCAGCATACACTGCGGGTGCGCAACC
TGTGCGCGCCGACGCAGCCCTGTTATCCCCCGGCGCGTGACCGTTTCCACTGGCGGGTTCTCAGCCACTT
AGGCTCCAACTTCCTGTCAATGATGGACAACGCCGAAATCTTGCGCGGCACGCTGGCGCTGTACGACTGG
ACGGAAAGCGAAATGAACCGACGCCGTCTGGAGGCAATCGTTGACGTTCAGCATCACCTGATTCAGCGTT
TTGAAAAAGGTTTTCTACTGCGCGGCGTGGATATTCAGGTCACGCTGGACAGCAACGGTTTCGCCGGCGA
AGGCGATATCACCCTGTTTGGCGAACTGCTGCACCGCTTTTTCGCCCTGTATGCCGACATCCACTTATTT
ACTCAGTTGACGCTGATTCTGCAACCTACAGGAAAATGTTTGCAATGGACAGAACACCACAGCCAGCGCG
TACCGGGCTGA