SecReT6
Protein ID: 206577610
SecReT6 ID306
T6SS typei2
Gene symbol-
Locus tagKPK_3069
StrainKlebsiella pneumoniae 342
Repliconchromosome [GenBank: NC_011283] [Browse all T6SS(s) in this replicon]
Location [Strand]3124928..3125419 [-]
Producthypothetical protein
NoteTssB
UniProt IDB5XRS1
KEGG IDkpe:KPK_3069
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.20E-53, Aligned region: 6..158
Protein Sequence: 163 a.a.     [Download]
>gi|206577610|ref|YP_002238895.1| unnamed protein product [Klebsiella pneumoniae 342]
MADTFQNEVPRARINLKLSLHTGGAQKKVELPLKLLTIGDFSHGKENRPLSEREKINVNKNNFNSVLSEF
SPEVNLSVPNTLSGNGEEENVRLRFTDIKDFEPEQVARQIPQLRAMLAMRNLLRDLKSNLLDNATFRKEL
EAILKDPALSQELRDEMSALAPK
 
Nucleotide Sequence: 492 bp     [Download]
>gi|206575712|ref|NC_011283.1|:c3125419-3124928 Klebsiella pneumoniae 342 chromosome, complete genome
ATGGCTGATACGTTCCAGAATGAAGTCCCCAGGGCGCGCATTAATCTCAAATTATCTCTTCATACCGGCG
GCGCGCAGAAGAAGGTCGAACTGCCGCTGAAGCTGCTTACCATTGGCGATTTTAGTCATGGTAAGGAAAA
CCGGCCTTTATCGGAAAGAGAAAAAATCAACGTCAATAAAAATAACTTTAACAGCGTACTTTCGGAATTT
AGCCCGGAAGTTAACCTCTCGGTGCCGAATACGCTGTCCGGCAACGGCGAAGAGGAGAACGTCAGACTGC
GTTTTACCGATATCAAAGATTTTGAACCGGAGCAGGTTGCCCGGCAAATTCCGCAACTCCGCGCCATGCT
GGCGATGCGTAATTTATTACGCGATCTCAAATCCAATCTGCTTGATAACGCCACTTTCAGAAAAGAGCTT
GAGGCAATCCTGAAAGATCCGGCGCTGTCCCAGGAATTACGCGACGAAATGAGTGCGCTTGCCCCGAAAT
AA