SecReT6
Protein ID: 206577667
SecReT6 ID306
T6SS typei2
Gene symbol-
Locus tagKPK_3062
StrainKlebsiella pneumoniae 342
Repliconchromosome [GenBank: NC_011283] [Browse all T6SS(s) in this replicon]
Location [Strand]3113816..3116185 [-]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDB5XRR4
KEGG IDkpe:KPK_3062
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 9.20E-66, Aligned region: 31..353
DUF2345 [PF10106], Evalue: 1.10E-41, Aligned region: 610..756
T6SS_Vgr [PF13296], Evalue: 8.10E-33, Aligned region: 486..588
T6SS_Vgr [PF13296], Evalue: 8.10E-33, Aligned region: 625..674
Phage_base_V [PF04717], Evalue: 1.20E-16, Aligned region: 336..354
Phage_base_V [PF04717], Evalue: 1.20E-16, Aligned region: 386..479
Protein Sequence: 789 a.a.     [Download]
>gi|206577667|ref|YP_002238888.1| unnamed protein product [Klebsiella pneumoniae 342]
MKSLLFSHNHHLLSVKGCEAGLDVLAFEGDEALSQPFRYRIEFTSADHAISKEMMLMKAASLTLQAPVAQ
GFGINVQQPVRVIQGVVTGFERLSTSRDETHYALTLQPRLALLNRSHQNAIYQDQSVPQIVEKILRERHG
LRGQDFLFSLTKTYPRREQVMQYGEDDLRFITRLLGEVGIWFRFTADTRLHIDVAEFCDSQQGYEKGLTL
PSVPPSGQQSAGVDAVWEMACRHRVVEQQVSTRDYNYREATADMSAQVDVTRGETTTFGEAYHWGDNYLT
AGNAHDRHPAPESGAFYARLRHERYLNGQTRMQATTSCPTLCPGQVLKVIGGEEVAGEFAEGVLVTAMHS
HARRDADFAVEFAGIPDSPDVGYRPEPGARPVMAGTLPARVTSTRENDTYGHIDKHGRYRVNMLFDRARW
ETGFESLWVRQSRPYAGDTYGLHLPLLAGTEVAIGFEDGNPDRPYIAGVLHDSAHGDHVTIRNDKRNVLR
TPANNKIRLDDERGKEHIKVSTEYGGKSQLNLGHLVDSDRRPRGEGFELRTDSRGAIRAQKGIFISADGQ
AKAQGQVLAMEPAVSLLKGAVNQVTEWGSITQTHHNVIPDTGPLSALTTGTSDLKQPTLLMSAPQGIAAV
TPETTLLHSGNGLYLQSLGEVNITTAQRCSLNASQAISLLAQQEGMRLVSAKGPLEVESHGEILSLTALK
DITVQSTQGHLQLTAKNGITLGCGGAYIRLTPQGEVQIHGPGVISLKGQHDLQGPVSEAFPLPELPASVC
KECLKKAQALAQGFVPREA
 
Nucleotide Sequence: 2370 bp     [Download]
>gi|206575712|ref|NC_011283.1|:c3116185-3113816 Klebsiella pneumoniae 342 chromosome, complete genome
GTGAAATCGTTGTTGTTCAGCCATAACCACCACCTGCTTTCGGTGAAGGGATGTGAAGCCGGGCTTGATG
TGCTGGCCTTCGAGGGCGATGAAGCCCTGAGCCAGCCGTTCCGCTACCGTATTGAATTCACCAGCGCAGA
CCATGCCATCAGCAAAGAGATGATGCTGATGAAGGCAGCCTCCCTGACGCTGCAGGCGCCGGTGGCTCAG
GGCTTCGGCATCAATGTTCAGCAACCCGTGCGGGTGATCCAGGGCGTGGTGACGGGGTTTGAACGGCTCA
GTACCTCCAGGGATGAAACGCACTACGCGCTGACGCTTCAGCCGCGCCTGGCGCTGCTTAACCGCTCGCA
CCAGAACGCCATTTACCAGGACCAGTCCGTTCCGCAGATTGTGGAAAAAATCCTCCGCGAGCGCCACGGC
CTGCGCGGTCAGGATTTTCTGTTCTCACTGACAAAAACGTATCCGCGCCGCGAGCAGGTGATGCAGTACG
GCGAGGATGACCTGCGCTTTATCACCCGGCTGCTGGGTGAGGTGGGGATCTGGTTTCGCTTTACCGCCGA
CACGCGGCTGCACATCGACGTCGCTGAGTTCTGCGACAGTCAGCAGGGTTATGAGAAGGGGCTGACGTTG
CCTTCGGTCCCGCCGTCAGGGCAGCAGTCGGCCGGGGTGGACGCGGTGTGGGAGATGGCATGCCGCCACC
GTGTCGTGGAGCAGCAGGTCAGTACCCGCGACTACAACTACCGCGAGGCGACGGCGGACATGAGCGCGCA
GGTGGATGTCACCCGCGGGGAGACCACCACCTTCGGTGAGGCTTACCACTGGGGAGATAACTACCTGACG
GCGGGGAATGCCCATGACCGGCATCCGGCGCCGGAGTCCGGGGCGTTTTACGCCCGCCTTCGCCATGAGC
GTTATCTGAACGGCCAGACCCGGATGCAGGCCACCACCAGCTGCCCGACGCTCTGCCCGGGACAGGTGTT
GAAGGTCATCGGCGGAGAGGAGGTGGCCGGGGAGTTTGCTGAGGGCGTGCTCGTCACGGCGATGCACAGC
CACGCCCGGCGCGATGCGGATTTTGCGGTGGAGTTTGCCGGCATACCGGACAGCCCGGACGTCGGCTACC
GGCCTGAGCCCGGCGCGCGTCCGGTGATGGCCGGGACGCTGCCGGCCCGCGTGACCAGCACCCGGGAAAA
CGACACCTACGGGCATATCGACAAACACGGACGCTACCGGGTGAATATGCTGTTTGACCGGGCGCGCTGG
GAAACCGGGTTCGAGAGCCTGTGGGTCCGTCAGTCGCGGCCGTATGCCGGAGACACTTACGGCCTGCACC
TGCCGCTGCTGGCGGGGACGGAGGTGGCGATTGGCTTTGAGGATGGTAACCCTGACCGGCCGTATATCGC
GGGCGTCCTCCACGACTCGGCGCACGGCGACCACGTCACCATCCGCAATGACAAACGTAACGTCCTGCGC
ACCCCGGCCAACAACAAAATCCGCCTCGACGATGAGCGCGGGAAAGAACATATCAAGGTCAGCACGGAGT
ACGGCGGTAAAAGCCAGCTGAACCTGGGGCACCTGGTGGACAGTGACAGGCGGCCGCGCGGCGAAGGCTT
TGAGCTGAGAACCGACAGCCGGGGAGCTATCCGGGCACAGAAAGGGATATTTATCAGCGCGGACGGACAG
GCGAAGGCTCAGGGGCAGGTGCTGGCGATGGAGCCGGCGGTCAGTTTGCTGAAAGGTGCGGTGAATCAGG
TCACGGAATGGGGCAGCATTACGCAAACCCATCATAATGTTATCCCAGACACCGGCCCATTAAGCGCACT
GACCACAGGCACCAGCGATCTTAAACAGCCGACATTGCTGATGTCGGCCCCGCAGGGGATTGCCGCAGTC
ACGCCGGAAACAACCCTCCTGCACAGCGGTAACGGGCTGTATCTGCAGAGCCTGGGGGAGGTCAACATCA
CCACGGCACAGCGCTGTTCTCTGAATGCCAGCCAGGCTATTTCACTGCTGGCGCAACAGGAGGGGATGAG
GCTGGTCTCCGCCAAAGGTCCGCTGGAAGTAGAGTCGCACGGCGAGATTCTGTCGCTGACCGCGCTAAAA
GATATCACCGTCCAGTCAACCCAGGGGCATCTGCAGTTGACGGCTAAAAATGGCATCACCCTGGGTTGCG
GCGGCGCATATATCCGTCTTACCCCGCAGGGAGAGGTACAGATCCACGGACCGGGGGTGATTAGCCTTAA
GGGGCAGCATGATTTGCAGGGGCCGGTCAGCGAGGCGTTTCCCTTGCCTGAGCTACCGGCATCGGTGTGT
AAAGAGTGCCTTAAAAAAGCCCAGGCGCTGGCGCAGGGCTTCGTGCCGCGGGAGGCATAG