SecReT6
Protein ID: 206577990
SecReT6 ID304
T6SS typeN/A
Gene symbol-
Locus tagKPK_0947
StrainKlebsiella pneumoniae 342
Repliconchromosome [GenBank: NC_011283] [Browse all T6SS(s) in this replicon]
Location [Strand]960544..961884 [-]
Producthypothetical protein
NoteTssK
UniProt IDB5XUX0
KEGG IDkpe:KPK_0947
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.60E-131, Aligned region: 18..443
Protein Sequence: 446 a.a.     [Download]
>gi|206577990|ref|YP_002236819.1| unnamed protein product [Klebsiella pneumoniae 342]
MKIHRPLWAEGTFLSSQQFQQQARWETYSNNSIAQLGIRHPWGVARVEFDREALALGKLKLRTLRLRFSD
GSLIDSEVSDALPLACDLHTLAVENTAIVVLALPLEHANGGNLGQEKHTERPLRYRQEWHKVQDIYGSDS
EEMAVECHALSLRFAHDNNQDYITCPLARLTRNGQGNWSQDESYIPPLLALSAHIGLVERLDTLLLQLQA
KCRHLMALRRESNQRMADFAVADVSLFWLLNALNSAEPVLSDFLRYPSIHPELVWRELARLAGALLTFSL
EHNVSAIPAYVHDAPASVFPPLFTLLSELLEASLPSRVIALELESLPGNRWKAELHDPRLREEADFYLSV
RSSLPTHVVLQQLPRLCKIGAPNDVTLLVNVALNGVPVVPLTQVPAALPLRLENQYFALDMQSAPAKAML
DAGCCMIYAPGTLGDLKPELFAVLRS
 
Nucleotide Sequence: 1341 bp     [Download]
>gi|206575712|ref|NC_011283.1|:c961884-960544 Klebsiella pneumoniae 342 chromosome, complete genome
ATGAAAATTCATCGACCACTATGGGCTGAGGGAACGTTCCTGTCCTCACAACAGTTTCAGCAGCAGGCCC
GCTGGGAAACGTACAGTAACAACAGCATTGCACAGCTGGGTATCCGTCATCCATGGGGTGTGGCGAGGGT
CGAGTTTGACAGAGAAGCACTGGCGTTAGGGAAGTTAAAATTACGTACCCTGCGCCTGCGTTTTTCCGAT
GGCTCGTTGATCGACTCCGAAGTTTCCGATGCGCTGCCTCTGGCTTGTGATTTACATACTCTGGCGGTGG
AAAATACGGCAATAGTTGTCCTGGCGTTACCGCTGGAACATGCGAATGGCGGTAATCTGGGACAGGAAAA
GCATACTGAAAGACCCCTGCGTTATCGTCAGGAATGGCATAAAGTACAAGATATTTATGGCAGCGACAGT
GAAGAAATGGCCGTTGAATGCCATGCGCTGTCATTGCGTTTCGCCCATGATAACAATCAGGATTACATCA
CCTGCCCGCTTGCACGTCTGACGCGGAATGGTCAGGGTAACTGGTCTCAGGATGAAAGCTACATCCCGCC
GCTGCTGGCCCTCAGCGCACATATTGGTCTGGTGGAGCGACTGGATACGTTGCTGTTGCAGCTACAAGCG
AAGTGCCGGCATCTGATGGCCCTGCGCCGGGAAAGCAATCAGCGTATGGCGGACTTCGCGGTAGCGGATG
TGTCCCTGTTCTGGTTACTCAATGCGTTGAACAGCGCTGAACCGGTTCTAAGTGATTTTTTACGGTATCC
GAGCATCCATCCTGAACTCGTCTGGCGCGAACTGGCTCGTCTGGCCGGCGCGTTGCTGACCTTTTCCCTT
GAACACAACGTGAGCGCCATTCCCGCATATGTCCATGATGCTCCAGCCTCCGTTTTTCCGCCGCTTTTTA
CCCTGCTCAGCGAACTGCTCGAAGCCAGCCTGCCGTCGCGGGTGATTGCGCTCGAGCTGGAATCCCTTCC
CGGCAACCGCTGGAAAGCCGAACTTCACGATCCACGCCTGCGGGAAGAGGCGGATTTTTACCTTTCTGTT
CGCTCCTCGCTGCCGACGCACGTCGTTCTGCAACAGTTACCACGGCTCTGCAAAATCGGGGCGCCGAATG
ACGTTACGTTGTTGGTTAATGTTGCGCTGAACGGTGTCCCTGTTGTTCCGCTGACGCAGGTTCCGGCTGC
ATTGCCATTACGGCTGGAGAATCAGTACTTTGCGCTGGATATGCAGAGCGCTCCGGCTAAAGCCATGCTG
GATGCCGGGTGCTGCATGATTTACGCGCCGGGTACGCTGGGCGATCTGAAACCCGAGCTTTTTGCGGTAC
TGCGGTCATGA