SecReT6
Protein ID: 206578457
SecReT6 ID304
T6SS typeN/A
Gene symbol-
Locus tagKPK_0944
StrainKlebsiella pneumoniae 342
Repliconchromosome [GenBank: NC_011283] [Browse all T6SS(s) in this replicon]
Location [Strand]955480..957960 [-]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDB5XUW7
KEGG IDkpe:KPK_0944
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.90E-61, Aligned region: 31..347
DUF2345 [PF10106], Evalue: 2.10E-48, Aligned region: 600..751
T6SS_Vgr [PF13296], Evalue: 7.80E-38, Aligned region: 480..585
T6SS_Vgr [PF13296], Evalue: 7.80E-38, Aligned region: 783..815
Phage_base_V [PF04717], Evalue: 2.60E-14, Aligned region: 392..473
Sarcoglycan_1 [PF04790], Evalue: 0.0031, Aligned region: 540..553
Sarcoglycan_1 [PF04790], Evalue: 0.0031, Aligned region: 662..725
Protein Sequence: 826 a.a.     [Download]
>gi|206578457|ref|YP_002236816.1| unnamed protein product [Klebsiella pneumoniae 342]
MDVQNFDHSHHALKIRGLSSGVDVLSFEGKEQLSAPFRYDIQFTSSDKSIAPESVLMQDGAFSLTAPPVQ
GIPTQTPLRTLYGVITGFKQLSSSRDEARYEVRLEPRLALLSRSHQNAIYQNQTVPQIVEKILRERHEMR
GQDFVFNLKSDYPSREQVMQYDEDDLTFISRLLSEVGIWFRFSTDARLKIGVIEFYDDQSGYERGLTLPL
RHPSGMSDSGTEAVWDLNTAYSVVSRSVTTRDYNYREAMAEMTTGQFDVTGGDNTTYGEAYHYADNFLKT
GDKATPESGAFYARIRHERYLNGRAILKGQSTSSLLMPGLEIKVEGNDAPEVFRKGILITGITASAARDR
SYELTFTAIPYSERYGYRPPLIRRPVMAGTLPARVTSTTANDVYAHIDKDGRYRVNLDFDRDTWKPGFES
LWVRQSRPYAGDTYGLHLPLLAGTEVSIAFEDGNPDRPYIAGVKHDSAHTDHVTIQNYKRNVLRTPANNK
IRLDDERGKEHIKVSTEYGGKSQLNLGHLVDAGKQQRGEGFELRTDMWGAIRAKKGVFISADAQEKAQGQ
ALMMDEALSQLQEALSLVEALHSAAEVAKSELADLQTQKTLLSETLTELKKSALLFSAPAGIAQVTPKSL
QLSSGENLISTSGKNTDFSVFKKFTVAAGEAVSLFAQKLGIKIFASKGKVEIQAQSDEMLLDACKDLRIS
SSDGKILISAKNEIILTSGGGYIRIGGGTVECAAPYKIIERGAVWQKFSGQSISQAMQEWDSTDFAITPE
ILWKQTGKPAKNQKVRVTRGDGTIVEMTTDDQGKLPVQSGLFVESIKIDLLDNQED
 
Nucleotide Sequence: 2481 bp     [Download]
>gi|206575712|ref|NC_011283.1|:c957960-955480 Klebsiella pneumoniae 342 chromosome, complete genome
ATGGATGTACAGAACTTCGACCACTCACACCACGCGTTAAAAATCCGCGGCCTGAGCAGCGGCGTGGACG
TACTGTCCTTTGAAGGCAAGGAGCAATTAAGCGCCCCATTCCGCTATGACATTCAGTTTACCAGCAGCGA
TAAGTCTATTGCGCCGGAGTCGGTGCTGATGCAGGACGGGGCATTCAGCCTGACCGCCCCGCCGGTGCAA
GGGATACCGACGCAGACTCCCCTGCGTACGTTGTACGGGGTGATCACAGGATTTAAGCAATTGTCTTCCT
CACGGGACGAGGCGCGGTATGAGGTGCGGCTGGAGCCCCGTCTGGCGCTACTGTCCCGCAGCCATCAGAA
CGCGATTTATCAGAACCAGACGGTGCCGCAAATCGTGGAGAAAATACTCCGCGAGCGGCATGAGATGCGC
GGTCAGGACTTTGTGTTTAACCTGAAAAGCGACTACCCGTCACGCGAGCAGGTCATGCAGTACGACGAAG
ACGATCTGACATTCATCTCACGGTTGCTGTCGGAGGTGGGTATCTGGTTCCGGTTCAGTACCGACGCCCG
ACTGAAAATCGGGGTTATCGAGTTTTACGACGACCAGAGTGGCTATGAGCGCGGCCTGACGCTGCCGCTG
CGTCACCCTTCGGGGATGAGCGACAGCGGAACCGAAGCAGTGTGGGATCTGAACACGGCCTACAGCGTGG
TATCGAGGTCCGTCACGACGCGGGATTACAACTACCGTGAAGCGATGGCGGAGATGACAACAGGCCAGTT
TGACGTAACAGGCGGGGATAACACCACCTACGGTGAAGCCTATCATTACGCTGACAATTTTCTGAAAACG
GGTGACAAAGCGACGCCGGAGAGTGGTGCATTCTATGCGCGTATCCGCCACGAACGCTACCTGAACGGAC
GCGCCATCCTGAAAGGACAGAGCACCAGTTCTCTGCTGATGCCGGGGCTGGAGATAAAGGTCGAGGGTAA
TGATGCGCCAGAGGTATTCCGCAAGGGCATTCTGATAACCGGGATTACCGCCAGCGCAGCACGAGACCGC
AGTTACGAACTGACATTCACCGCCATCCCCTATTCCGAACGCTACGGCTACCGCCCTCCTCTCATCCGCA
GGCCTGTGATGGCAGGGACACTCCCGGCGCGGGTGACCAGCACCACGGCAAATGATGTCTACGCTCATAT
CGACAAAGACGGGCGCTATCGAGTGAACCTGGACTTTGACCGGGATACGTGGAAGCCGGGTTTCGAGAGC
CTGTGGGTACGGCAGTCACGCCCCTATGCGGGAGATACTTACGGTCTGCACCTGCCGCTGCTGGCGGGAA
CCGAGGTTAGCATCGCGTTTGAGGATGGCAACCCGGACAGGCCATATATCGCCGGGGTGAAACACGACTC
GGCGCACACCGACCATGTGACCATCCAGAACTATAAGCGCAACGTGCTGCGCACCCCGGCGAATAACAAA
ATCCGGCTGGACGATGAGCGGGGTAAGGAGCACATCAAGGTTAGCACAGAGTACGGCGGAAAGAGCCAGC
TGAACCTGGGACATCTGGTGGATGCTGGGAAGCAGCAGCGCGGTGAGGGTTTCGAACTGCGCACCGATAT
GTGGGGTGCGATAAGAGCGAAAAAAGGTGTCTTTATCAGCGCCGATGCGCAGGAAAAGGCGCAGGGGCAG
GCGCTGATGATGGATGAAGCGTTAAGCCAGCTCCAGGAAGCGCTGTCTTTAGTGGAAGCACTACATAGCG
CCGCTGAAGTGGCAAAATCAGAGCTGGCGGATTTACAGACACAAAAAACGCTATTGTCAGAAACGCTGAC
CGAGCTGAAAAAATCAGCGCTACTGTTTTCTGCTCCCGCGGGGATTGCACAGGTTACGCCCAAAAGCCTG
CAATTATCCTCAGGGGAAAACCTGATTAGCACCAGTGGGAAAAATACGGATTTCAGCGTATTTAAAAAAT
TCACTGTAGCGGCGGGAGAAGCAGTCAGTCTGTTTGCTCAAAAGCTTGGTATTAAAATTTTCGCCAGCAA
AGGCAAAGTGGAGATTCAGGCACAAAGCGATGAAATGCTCCTGGATGCATGTAAAGATCTGCGCATAAGC
AGTAGCGACGGAAAAATTCTTATTAGCGCAAAAAATGAAATCATCCTAACCAGTGGTGGTGGATATATTC
GAATTGGAGGTGGCACGGTGGAATGTGCCGCACCATATAAAATTATAGAGCGTGGAGCGGTTTGGCAAAA
ATTCAGTGGTCAGAGTATCAGTCAGGCCATGCAGGAATGGGATTCCACTGATTTTGCCATCACCCCTGAG
ATCCTCTGGAAGCAAACCGGCAAACCGGCAAAGAATCAAAAGGTACGCGTTACCCGCGGCGATGGCACTA
TCGTTGAAATGACGACTGACGATCAAGGGAAACTACCTGTGCAGAGCGGGCTTTTTGTTGAATCAATAAA
AATTGATCTGTTAGATAATCAGGAAGATTAA