SecReT6
Protein ID: 206579068
SecReT6 ID304
T6SS typeN/A
Gene symbol-
Locus tagKPK_0936
StrainKlebsiella pneumoniae 342
Repliconchromosome [GenBank: NC_011283] [Browse all T6SS(s) in this replicon]
Location [Strand]943023..943556 [-]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDB5XUV9
KEGG IDkpe:KPK_0936
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.10E-35, Aligned region: 18..167
Protein Sequence: 177 a.a.     [Download]
>gi|206579068|ref|YP_002236808.1| unnamed protein product [Klebsiella pneumoniae 342]
MFLTPYKRHAVSVLAAATLLSGCGLTQRVTDGTKEVASAIFYKQIKTLHLDFVSRSALNTDAQDTPLSTM
IHVWQLKTRERFDEANYDTLLMQEEKTLKSDVLAKHTVWMKPAGAVSLNVPLDKETQFVAIVGQFYHPDE
QSNSWRLVLKRDELEADRPRTIELMRSDLRLLPLQDK
 
Nucleotide Sequence: 534 bp     [Download]
>gi|206575712|ref|NC_011283.1|:c943556-943023 Klebsiella pneumoniae 342 chromosome, complete genome
ATGTTTCTTACACCCTATAAACGACATGCTGTCAGCGTACTTGCCGCCGCGACGCTGCTGAGCGGCTGCG
GTCTGACCCAGAGAGTGACTGACGGCACTAAAGAAGTAGCATCGGCGATTTTCTACAAGCAGATCAAAAC
GCTGCATCTCGATTTTGTATCGCGCAGCGCGCTGAATACAGATGCGCAAGACACACCGCTTTCCACGATG
ATCCATGTCTGGCAATTGAAAACACGTGAGCGTTTTGACGAGGCCAACTATGACACGCTGCTTATGCAGG
AAGAAAAAACGCTGAAATCAGATGTACTGGCCAAACATACCGTCTGGATGAAGCCAGCGGGTGCGGTTTC
CCTGAATGTCCCTCTGGATAAAGAGACCCAGTTTGTCGCCATCGTTGGTCAGTTTTATCACCCCGATGAA
CAAAGCAACAGTTGGCGACTGGTACTCAAAAGGGATGAACTGGAAGCTGACAGGCCCCGCACCATAGAGC
TGATGAGAAGCGATCTCCGCCTGCTCCCCCTTCAGGATAAGTAA