SecReT6
Protein ID: 206579269
SecReT6 ID306
T6SS typei2
Gene symbol-
Locus tagKPK_3066
StrainKlebsiella pneumoniae 342
Repliconchromosome [GenBank: NC_011283] [Browse all T6SS(s) in this replicon]
Location [Strand]3121302..3121991 [-]
Producttype IV/VI secretion system protein, DotU family
NoteTssL
UniProt IDB5XRR8
KEGG IDkpe:KPK_3066
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.70E-38, Aligned region: 14..216
Protein Sequence: 229 a.a.     [Download]
>gi|206579269|ref|YP_002238892.1| unnamed protein product [Klebsiella pneumoniae 342]
MNEPKRGNAASIDIDALLQNTWLQVISLRHGPQFRDEEGYTLWQRCIADVECVQHELKASGLDDASCQHI
LTAQCALLDEAVKGRGVEDEACLQWYDIPLQGHFLGTMDAGDTLCDRMRDVLREPAPDLAVVTCFQRVML
LGFVGSFRSLNDPERLKLINALSEHVPPFQCPSTAPVLVENRAGLGISGWLASWPVRIGLSVVVVLVLWW
GLNHWLDHLLLTLLPGTVK
 
Nucleotide Sequence: 690 bp     [Download]
>gi|206575712|ref|NC_011283.1|:c3121991-3121302 Klebsiella pneumoniae 342 chromosome, complete genome
GTGAATGAGCCTAAACGCGGCAACGCCGCGTCCATTGATATTGATGCGCTGCTGCAGAACACCTGGCTAC
AGGTTATCAGCCTGCGCCACGGCCCGCAGTTCCGCGATGAGGAAGGGTACACGCTATGGCAGCGCTGTAT
TGCTGATGTCGAGTGCGTGCAACATGAGCTGAAGGCGAGCGGGCTTGATGACGCCAGCTGTCAGCATATT
CTCACCGCCCAGTGCGCGCTGCTCGATGAAGCCGTGAAAGGGCGCGGCGTGGAGGATGAGGCCTGCCTGC
AGTGGTATGACATTCCGCTGCAGGGGCACTTCCTCGGCACCATGGATGCCGGTGATACGCTGTGCGATCG
GATGCGTGATGTGCTGCGTGAACCGGCGCCCGACCTGGCCGTGGTCACTTGTTTTCAGCGGGTGATGCTG
CTGGGTTTTGTTGGCAGCTTTCGCTCCCTCAACGATCCCGAGCGCCTGAAGCTGATCAACGCGCTCAGTG
AGCATGTCCCACCTTTTCAATGCCCGTCAACCGCTCCCGTACTGGTAGAGAATCGCGCCGGACTGGGGAT
AAGCGGCTGGCTGGCCTCCTGGCCGGTACGTATTGGCCTGAGCGTGGTGGTGGTACTCGTCCTGTGGTGG
GGGCTGAACCACTGGCTCGATCACCTGCTGCTGACCCTGTTACCGGGGACGGTGAAATGA