SecReT6
Protein ID: 206579667
SecReT6 ID306
T6SS typei2
Gene symbol-
Locus tagKPK_3065
StrainKlebsiella pneumoniae 342
Repliconchromosome [GenBank: NC_011283] [Browse all T6SS(s) in this replicon]
Location [Strand]3119602..3121305 [-]
ProductOmpA domain-containing protein
NoteTagL
UniProt IDB5XRR7, B5XRR7
KEGG IDkpe:KPK_3065
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 5.10E-16, Aligned region: 148..159
OmpA [PF00691], Evalue: 5.10E-16, Aligned region: 437..533
DUF4131 [PF13567], Evalue: 0.0012, Aligned region: 8..75
DUF4131 [PF13567], Evalue: 0.0012, Aligned region: 277..344
Protein Sequence: 567 a.a.     [Download]
>gi|206579667|ref|YP_002238891.1| unnamed protein product [Klebsiella pneumoniae 342]
MSPAQQRGLALWASLLSAMVCLLFLPVPRWGAWLILLVTLALIIGIWCIASRRTGRNVASTLAPLPEGAY
RQPVVLVCGDLPFVWSQKSPVRVVKQGCWIRVEKTEELQQVARQVLSQRPEWGPQLSVLLCVCPQRHAQS
DALTSALLALRWQLSQLRQQTGYAVPLALQGQVGSAMSPILLWQAAMPGEAVKVWQPSCAPCSVPAWVSA
GGAAALEQQVLMNSLMGWFEQHVHAVLTEENTDLPPLTPAAVLWGLGPSLPGSLASSAWTTWLSRHSGLS
RVAGWQPDESDTEDASALPEFILPQLPAGRGLTPRGRAWRAALAIFTLAAVAALLSSGWNNRQLLQRVGV
DIARYERIAMDDYRPKASAVRVLREDAALLDSWARNGVPLRLSLGLYRGEQIRLPLLEAIRGYVPPPPPR
PVQRVAPDVIRLDSMSLFDTGKWVLKPGSTKRLVNSLMDIKARPGWLIVVAGHTDSVGEEKANQLLSLKR
AESVRDWMRDTGDVPDSCFAVQGYGESRPIATNDTPEGRALNRRVEISLVPQVDACRLPDQPSASSQDDG
ASLHNGE
 
Nucleotide Sequence: 1704 bp     [Download]
>gi|206575712|ref|NC_011283.1|:c3121305-3119602 Klebsiella pneumoniae 342 chromosome, complete genome
ATGAGCCCCGCGCAGCAGCGTGGGCTGGCGCTGTGGGCCAGTCTGCTGAGTGCGATGGTGTGCCTGCTAT
TTTTGCCGGTTCCCCGCTGGGGGGCGTGGCTCATTCTGCTGGTCACGCTGGCCCTGATCATCGGGATCTG
GTGCATCGCCAGTCGTCGTACCGGACGTAACGTCGCATCAACCCTGGCCCCTCTCCCGGAGGGCGCTTAT
CGCCAGCCGGTGGTCCTCGTTTGCGGCGATCTGCCGTTTGTCTGGTCGCAAAAGTCTCCGGTGCGGGTCG
TCAAACAGGGCTGCTGGATCCGCGTGGAAAAGACGGAGGAGCTGCAGCAGGTCGCGCGCCAGGTATTGAG
CCAGCGGCCGGAATGGGGGCCTCAGCTGTCGGTGCTGCTCTGCGTCTGCCCGCAGCGGCATGCGCAAAGC
GATGCGCTGACCAGCGCTCTGCTGGCCCTGCGCTGGCAACTCAGCCAGCTGCGTCAGCAGACGGGGTATG
CCGTACCGCTGGCGCTGCAGGGGCAGGTGGGCAGCGCGATGAGTCCCATCCTGCTCTGGCAGGCGGCGAT
GCCGGGTGAAGCGGTGAAAGTCTGGCAGCCCTCCTGCGCCCCCTGTTCCGTACCGGCCTGGGTAAGCGCC
GGCGGGGCGGCCGCGCTGGAGCAGCAGGTGCTGATGAACAGCCTGATGGGCTGGTTTGAACAGCACGTCC
ATGCCGTGTTGACGGAAGAGAATACCGACCTGCCGCCTCTGACCCCAGCGGCCGTGCTGTGGGGGCTCGG
GCCCTCGCTGCCTGGAAGTCTGGCATCGTCGGCCTGGACGACGTGGTTATCCCGACATAGCGGCCTGTCG
CGGGTAGCTGGCTGGCAGCCAGATGAGAGCGACACCGAGGACGCTTCAGCTTTGCCGGAATTCATCCTGC
CGCAGTTACCGGCGGGACGGGGACTCACGCCACGAGGCAGGGCCTGGCGCGCGGCGCTCGCGATTTTCAC
CCTCGCGGCTGTCGCCGCGCTGCTCAGCAGTGGCTGGAACAATCGACAACTGCTGCAGCGCGTGGGCGTC
GATATTGCCCGTTATGAGCGGATTGCGATGGATGATTATCGGCCAAAAGCCAGCGCTGTCAGGGTGCTGC
GTGAAGATGCCGCGCTGCTCGATAGCTGGGCGCGTAACGGTGTCCCGCTGCGCCTGAGTCTGGGCTTGTA
TCGCGGGGAGCAGATTCGCCTGCCGTTGCTGGAGGCGATTCGCGGTTACGTGCCGCCTCCGCCACCCAGG
CCGGTGCAGCGCGTCGCGCCGGACGTCATCCGCCTTGACAGCATGTCGCTATTCGATACCGGGAAATGGG
TACTGAAGCCTGGTTCGACAAAGCGGCTGGTCAACTCGCTGATGGACATTAAGGCCAGGCCCGGGTGGCT
GATCGTGGTGGCGGGCCACACCGACAGCGTCGGTGAGGAAAAAGCCAACCAGCTATTGTCGCTGAAACGT
GCGGAATCGGTCCGCGACTGGATGCGCGATACCGGCGACGTGCCGGACAGCTGCTTTGCCGTTCAGGGCT
ATGGCGAAAGCCGACCAATTGCAACAAACGATACGCCGGAAGGCCGTGCGCTGAACCGTCGTGTCGAAAT
CAGTCTGGTGCCGCAGGTAGACGCCTGCCGGTTACCGGACCAACCCTCTGCGTCATCCCAGGATGATGGC
GCTTCACTACACAATGGAGAGTAA