SecReT6
Protein ID: 206579851
SecReT6 ID304
T6SS typeN/A
Gene symbol-
Locus tagKPK_0937
StrainKlebsiella pneumoniae 342
Repliconchromosome [GenBank: NC_011283] [Browse all T6SS(s) in this replicon]
Location [Strand]943537..944619 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDB5XUW0
KEGG IDkpe:KPK_0937
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.50E-84, Aligned region: 19..320
Protein Sequence: 360 a.a.     [Download]
>gi|206579851|ref|YP_002236809.1| unnamed protein product [Klebsiella pneumoniae 342]
MDRTPQPARTGLTERLAPDINRINFYRFCQLLEQSQPQTPLLGSTTNPADDPVRFRPHPGMGFPVSELKS
VEQDLDHPDAPPTVRTTFLGLYGVDSPLPTAYLDYIAQRRDGHEAMMAFLDIFNHRFITQYYRIWRKYNY
PTSFEPGAVDNISRCLLGLIGLGIPGSENHIATPVSRFLALLSVMRLPTRTAEGITALVRLLAPQTKATV
IPHDPQQIVLPEPAGLSKRSRICLKTRALLGNTGTDVNSQLLLKLYTEDDGEARGWLPGGQLHTDLLVLL
RVYLGWRYQARLQLTLPVSLLPPVQLGKQRVQVSRTGVLRASFAAPVAGTVTVSLGRYQGLIPTSSTRNR
ESVTHVSYTL
 
Nucleotide Sequence: 1083 bp     [Download]
>gi|206575712|ref|NC_011283.1|:c944619-943537 Klebsiella pneumoniae 342 chromosome, complete genome
ATGGACAGAACACCACAGCCAGCGCGTACCGGGCTGACGGAAAGGCTTGCTCCGGACATTAACCGAATTA
ACTTTTACCGTTTCTGCCAGCTTCTTGAACAAAGCCAACCACAGACGCCACTGCTGGGGAGCACAACCAA
TCCGGCAGACGATCCTGTCCGTTTTCGTCCACATCCGGGGATGGGGTTCCCGGTCAGCGAACTAAAAAGC
GTCGAACAAGATTTGGATCATCCTGACGCGCCACCCACGGTGCGCACCACGTTTCTGGGGCTGTACGGTG
TGGATTCACCGCTGCCGACAGCTTATCTCGACTACATCGCGCAGCGCCGGGACGGCCATGAAGCGATGAT
GGCGTTTCTGGACATTTTTAACCATCGCTTTATCACTCAGTACTATCGTATCTGGCGCAAATATAATTAC
CCTACGTCGTTTGAACCGGGAGCCGTGGATAATATTTCCCGCTGCCTGCTGGGGTTGATTGGTCTGGGCA
TTCCCGGCAGCGAAAATCATATCGCCACGCCGGTCTCGCGTTTTCTTGCATTACTCAGCGTGATGCGTCT
GCCGACGCGTACAGCAGAAGGCATAACGGCGCTGGTCAGATTACTGGCCCCCCAGACGAAAGCGACAGTT
ATCCCGCACGATCCACAACAGATTGTCCTGCCTGAACCTGCGGGTTTATCAAAAAGATCGCGTATTTGCC
TGAAAACTCGGGCACTGCTGGGCAACACCGGCACTGACGTTAACAGCCAGTTACTGCTGAAGCTATATAC
CGAAGACGACGGAGAGGCACGCGGCTGGCTGCCGGGCGGGCAACTACATACCGACCTGCTGGTGCTGTTG
CGTGTCTATCTGGGCTGGCGCTACCAGGCCCGCCTGCAACTGACCTTGCCCGTCAGTCTGCTGCCTCCGG
TACAGTTGGGAAAACAGCGCGTTCAGGTAAGCCGAACGGGTGTGCTGCGGGCGTCTTTTGCTGCCCCAGT
CGCCGGTACGGTCACGGTCAGTCTCGGGCGTTATCAGGGACTCATACCCACATCATCCACCCGCAACAGG
GAGAGTGTTACTCATGTTTCTTACACCCTATAA