SecReT6
Protein ID: 206580274
SecReT6 ID306
T6SS typei2
Gene symbol-
Locus tagKPK_3068
StrainKlebsiella pneumoniae 342
Repliconchromosome [GenBank: NC_011283] [Browse all T6SS(s) in this replicon]
Location [Strand]3123341..3124885 [-]
Producttype VI secretion protein EvpB
NoteTssC
UniProt IDB5XRS0
KEGG IDkpe:KPK_3068
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 8.40E-172, Aligned region: 88..510
Protein Sequence: 514 a.a.     [Download]
>gi|206580274|ref|YP_002238894.1| unnamed protein product [Klebsiella pneumoniae 342]
MSVTTENAPVQGQTTLQENRAGEGVYASLFEKINLAPASHLGDINDFLDDAALSEAPAAERLTAAMQVFM
DRIRQSGQRVEKLDKTLIDHHIAELDFQISRQLDAVMHHQEFQQVESLWRGLKQLVDNTDYRQNVKTEIL
DVAKDDLRQDFEDAPELIQSGLYWHTYTAEYDTPGGEPIGSVISAYEFDASPQDVALLRNISRVSAAAHM
PFIGAVGPAFFLKETMEEVAAIKDIGNYFDRAEYIRWKSFRETDDARYIGLVMPRVLGRLPYGPDTVPVR
SFNYVEQVKGPDHEKYLWTSAAFSFASNMVKSFVNNGWCVQIRGPQAGGAVKDLPIHLYDLGTGNQVKIP
SEVMIPETREFEFASLGFIPLSYYKNRDYACFFSANSAQKPALYDTADATANSRINARLPYIFLLSRIAH
YLKMIQRENIGTTKDRRLLELELNTWVRSLVTEMTDPGDELQASHPLRDASVVVEDIEDNPGFFRVKLYA
VPHFQVEGMDVNLSLVSQMPKAKA
 
Nucleotide Sequence: 1545 bp     [Download]
>gi|206575712|ref|NC_011283.1|:c3124885-3123341 Klebsiella pneumoniae 342 chromosome, complete genome
ATGTCTGTTACCACAGAAAACGCCCCTGTTCAGGGGCAAACCACGCTGCAGGAAAATAGGGCGGGCGAGG
GCGTTTACGCCTCGCTGTTTGAAAAAATTAATCTCGCCCCGGCGTCTCACCTCGGGGATATCAACGACTT
TCTGGACGATGCCGCGCTCTCCGAAGCGCCGGCGGCGGAGCGTCTCACCGCGGCGATGCAGGTGTTTATG
GATCGCATCCGTCAGTCCGGTCAGCGGGTGGAAAAGCTCGACAAAACGCTGATTGACCACCATATCGCCG
AACTGGATTTCCAGATAAGCCGTCAGCTGGACGCGGTGATGCACCATCAGGAGTTTCAGCAGGTCGAATC
CCTGTGGCGCGGCCTCAAACAGCTGGTGGACAACACCGACTATCGGCAGAACGTCAAAACGGAGATCCTG
GACGTCGCCAAAGACGATCTGCGCCAGGACTTTGAGGACGCGCCGGAGCTTATCCAGAGCGGACTCTACT
GGCACACCTATACCGCGGAGTATGACACCCCCGGCGGCGAGCCGATCGGCTCGGTGATCTCGGCCTATGA
GTTCGACGCCAGCCCGCAGGATGTGGCGCTCCTGCGCAATATCTCCCGCGTCTCTGCGGCCGCCCATATG
CCGTTTATCGGCGCCGTCGGCCCGGCCTTCTTCCTGAAAGAGACCATGGAAGAGGTGGCTGCCATTAAGG
ATATCGGCAACTACTTCGATCGCGCGGAATATATCCGCTGGAAATCATTTCGTGAAACCGACGATGCCCG
CTACATCGGCCTGGTGATGCCGCGTGTGCTGGGTCGTCTACCGTACGGTCCGGACACCGTGCCGGTGCGC
AGCTTCAACTATGTCGAGCAGGTGAAGGGCCCGGACCACGAAAAATATCTCTGGACCAGCGCGGCGTTCT
CCTTCGCATCCAATATGGTGAAGAGCTTTGTCAATAACGGCTGGTGCGTGCAAATTCGCGGTCCGCAGGC
CGGCGGCGCGGTGAAAGATCTGCCCATCCATCTGTACGATCTGGGCACCGGCAACCAGGTGAAAATTCCT
TCCGAGGTGATGATCCCGGAAACGCGGGAGTTTGAGTTCGCCAGCCTGGGCTTTATCCCGCTGTCGTACT
ACAAAAATCGCGATTACGCCTGCTTCTTCTCGGCCAACTCCGCGCAGAAACCGGCGCTGTACGATACCGC
CGACGCCACCGCCAACAGCCGCATCAACGCGCGTCTGCCTTACATCTTCCTGCTGTCGCGCATCGCGCAC
TACCTGAAGATGATCCAGCGCGAGAATATCGGCACCACCAAGGACCGGCGGCTGCTGGAGCTGGAGCTGA
ACACCTGGGTGCGGAGCCTGGTGACTGAAATGACCGACCCCGGCGACGAGCTGCAGGCCTCCCATCCGCT
GCGCGATGCCAGCGTGGTGGTGGAAGATATTGAGGATAACCCGGGCTTCTTCCGCGTGAAGCTGTACGCG
GTGCCGCACTTCCAGGTCGAGGGGATGGACGTCAATCTGTCGCTGGTTAGCCAGATGCCAAAGGCGAAGG
CGTAG