SecReT6
Protein ID: 206580425
SecReT6 ID304
T6SS typeN/A
Gene symbol-
Locus tagKPK_0946
StrainKlebsiella pneumoniae 342
Repliconchromosome [GenBank: NC_011283] [Browse all T6SS(s) in this replicon]
Location [Strand]959882..960547 [-]
Producttype IV/VI secretion system protein, DotU family
NoteTssL
UniProt IDB5XUW9
KEGG IDkpe:KPK_0946
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.80E-47, Aligned region: 12..208
Protein Sequence: 221 a.a.     [Download]
>gi|206580425|ref|YP_002236818.1| unnamed protein product [Klebsiella pneumoniae 342]
MTQERKIDIDVLLRDTFLTVVELRQGTSARHGQELYRHCLQQVEGVRERLTAAGFSQQDIEHITYAQCAL
LDETVLSRDVMDDGQMVWLKNPLQSHFFNTLQAGELLYERMKRFLQEPAPTPAVLTCFHRVLLLGFRGRY
QDPESDERQHLIAMFSKRVEPFRVQEDSAVLNVPLTRRQHYLWQSPFCWLLLLMLVLVGVWWGLHSWLNV
LVDELLPTGKS
 
Nucleotide Sequence: 666 bp     [Download]
>gi|206575712|ref|NC_011283.1|:c960547-959882 Klebsiella pneumoniae 342 chromosome, complete genome
ATGACACAGGAACGGAAAATCGACATTGACGTACTACTTCGCGACACCTTTCTGACGGTGGTGGAACTGC
GTCAGGGCACTTCTGCAAGACACGGACAGGAACTATATCGCCATTGTCTGCAGCAGGTGGAAGGGGTACG
CGAGCGTCTGACAGCGGCCGGATTCAGCCAGCAGGACATAGAACATATCACTTACGCTCAGTGCGCGCTG
CTGGACGAAACCGTTCTCAGCCGGGACGTGATGGATGATGGCCAGATGGTCTGGCTAAAAAACCCTCTCC
AGTCGCATTTTTTCAATACCCTTCAGGCGGGCGAACTACTGTATGAGCGTATGAAGCGGTTTTTACAGGA
GCCAGCCCCCACGCCGGCGGTCCTGACCTGTTTTCATCGCGTGCTGTTGCTGGGGTTTCGCGGGCGCTAT
CAGGACCCCGAATCTGATGAACGGCAGCATCTCATTGCGATGTTCAGCAAGCGGGTTGAGCCATTCAGGG
TGCAAGAAGATTCGGCAGTGCTGAACGTGCCTTTGACCAGGCGTCAGCATTACCTGTGGCAGTCTCCTTT
TTGCTGGCTGCTACTGTTAATGCTTGTGCTGGTTGGCGTCTGGTGGGGGTTGCATAGCTGGCTGAATGTA
CTGGTGGATGAACTGCTGCCAACAGGCAAGTCTTGA