SecReT6
Protein ID: 206580585
SecReT6 ID304
T6SS typeN/A
Gene symbol-
Locus tagKPK_0945
StrainKlebsiella pneumoniae 342
Repliconchromosome [GenBank: NC_011283] [Browse all T6SS(s) in this replicon]
Location [Strand]958176..959879 [-]
ProductOmpA domain-containing protein
NoteTagL
UniProt IDB5XUW8, B5XUW8
KEGG IDkpe:KPK_0945
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 5.40E-17, Aligned region: 434..530
Protein Sequence: 567 a.a.     [Download]
>gi|206580585|ref|YP_002236817.1| unnamed protein product [Klebsiella pneumoniae 342]
MSRVSNTLKQALLLWSMLLVLALWLGFNQASTAMKFGVTVALIIIAVGLLACWRGKKRQTEADSAWLSRL
PPKTYRQPVVLVCGDAAASLFTENPLRQVAGGLYLHVADEEQLIRQAEVLLADRPAWASQLCVACTVVPV
VHLDMAVLAGRLRRFVGGLATVRRRAGIKVPLLLWSWLPGTGREDDLPWFICAGGKVQVVTPAGESSPTA
WAAQPGTDGSSLRLCHLLRMESLRQWLNQMVLPELNGYPPLAAGMGQAPSLPALEGNLWQTWTTAKTGLT
PEAIPKIGASPLPFPDMMLPLLPRQSGFTPVRRACVAALLMTTVAGVAALCLSATANRSLLLQVSDDLHK
YDAVPADNDAAKAHHLSVLKDDANILDSYFREGEPLRLSLGLYPGERLRQLVWRVIRDYRPPEKKKDVAD
ALPVQSVRLDSMALFDVGQARLKDGSTKVLINALVNIRARPGWLIVVTGYTDTTGNKKANQQLSLRRAEA
VRDWMLQTSDIPATCFAVQGLGESHPAATNDTPEGRAANRRVEISLVPRTDACQDVKQNMLPEPALSQLN
PQGVSAS
 
Nucleotide Sequence: 1704 bp     [Download]
>gi|206575712|ref|NC_011283.1|:c959879-958176 Klebsiella pneumoniae 342 chromosome, complete genome
ATGAGCCGGGTGAGTAACACGCTGAAACAGGCGCTTTTGCTGTGGAGCATGCTGCTGGTGCTGGCGCTAT
GGCTGGGATTCAATCAGGCCTCTACGGCGATGAAATTTGGCGTGACAGTGGCGCTTATCATCATCGCAGT
AGGCCTGCTGGCGTGCTGGCGCGGAAAAAAAAGACAGACTGAGGCCGACAGCGCATGGCTGTCCCGATTG
CCGCCCAAAACATATCGGCAGCCCGTAGTGCTGGTGTGCGGCGACGCGGCAGCATCGTTATTCACAGAAA
ACCCGCTGCGGCAGGTCGCGGGAGGGCTGTACCTGCACGTTGCGGATGAAGAGCAACTTATCAGACAGGC
TGAAGTGCTGCTAGCTGACCGCCCCGCATGGGCTTCTCAGTTATGTGTGGCCTGCACGGTCGTGCCGGTT
GTTCATCTGGATATGGCTGTTCTGGCGGGACGATTGCGACGCTTTGTCGGCGGTCTGGCGACAGTGCGCC
GCAGGGCGGGCATAAAAGTGCCGCTGCTGCTGTGGAGCTGGCTGCCCGGCACAGGGCGAGAGGATGATCT
ACCGTGGTTTATCTGCGCCGGCGGCAAGGTTCAGGTGGTGACGCCCGCCGGAGAAAGCTCTCCGACGGCA
TGGGCGGCACAGCCCGGAACCGATGGGAGCAGCCTGCGGCTTTGCCATCTTCTGCGGATGGAAAGCCTGA
GGCAGTGGCTCAATCAGATGGTGTTACCAGAGCTGAACGGGTATCCGCCGCTGGCGGCGGGCATGGGGCA
GGCGCCATCGCTGCCTGCGCTGGAAGGCAATCTGTGGCAGACATGGACAACGGCAAAAACGGGACTGACG
CCGGAGGCGATACCGAAGATCGGCGCATCTCCCCTGCCGTTCCCGGACATGATGCTGCCGCTGTTACCAC
GTCAATCAGGATTTACGCCAGTGCGCCGCGCCTGCGTGGCGGCGCTGCTGATGACCACCGTGGCAGGAGT
GGCTGCGCTCTGTCTGTCAGCAACCGCAAACCGCAGTCTGCTGCTGCAGGTGAGCGACGATCTACATAAA
TATGATGCCGTTCCGGCAGACAACGACGCCGCTAAAGCCCACCACCTGTCGGTCCTGAAGGACGATGCAA
ATATTCTGGATAGCTATTTTCGCGAAGGGGAGCCATTACGTCTCAGTCTGGGCTTATATCCCGGCGAACG
GCTACGCCAGCTGGTATGGCGGGTTATTCGCGATTACCGTCCACCTGAGAAAAAAAAGGATGTAGCAGAC
GCATTACCGGTACAGAGCGTGCGTCTCGACAGCATGGCGTTGTTTGACGTCGGACAGGCCCGTCTGAAAG
ACGGCTCGACAAAAGTGCTGATTAACGCGCTGGTAAATATCAGGGCAAGGCCGGGCTGGCTGATTGTGGT
CACCGGATATACCGATACCACCGGCAATAAAAAAGCCAATCAGCAATTGTCGCTGCGACGCGCGGAAGCC
GTGCGCGACTGGATGCTACAGACCAGCGACATTCCGGCCACCTGTTTTGCCGTACAGGGGCTGGGCGAAA
GCCATCCTGCGGCAACTAACGATACGCCGGAAGGCAGGGCCGCTAACCGGCGCGTCGAAATCAGTCTGGT
TCCCCGCACTGACGCCTGTCAGGACGTGAAACAGAACATGCTGCCAGAACCGGCGTTATCTCAGTTAAAT
CCACAAGGAGTTTCAGCCAGCTAA