SecReT6
Protein ID: 206580867
SecReT6 ID306
T6SS typei2
Gene symbol-
Locus tagKPK_3067
StrainKlebsiella pneumoniae 342
Repliconchromosome [GenBank: NC_011283] [Browse all T6SS(s) in this replicon]
Location [Strand]3121988..3123331 [-]
Producthypothetical protein
NoteTssK
UniProt IDB5XRR9
KEGG IDkpe:KPK_3067
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.80E-136, Aligned region: 19..444
Protein Sequence: 447 a.a.     [Download]
>gi|206580867|ref|YP_002238893.1| unnamed protein product [Klebsiella pneumoniae 342]
MMKTERPLWGRGIMVSPQHFQQQAAYAAWTAEVIARIGLNHPWGVVEATFEPEMLKLGRLQAHRLQVRFQ
DGTMIDTDNADALPSALSLDGADGEAVIVLALPLMQANGGNCLKPEEVAERPVRFRQRWRDVRNQFGEDT
RQIAVMQPELTLRFAHQDNSDYLTCPLVRLQRDSQGAWLIDETFLPPLLQIQGSRWLATQLEQLLTQLRA
RLTRLMAMRRESNERMADFAVADVSLFWLLNALNSAEPVLGYFLRDQQSPPERLYPELARLAGSLLTFSL
THQANAVPIYQHDHLNAVFPPLFDLLSDLLEASLPSRVVAIALEHDARLHFWQARLHDARLREGADYYLS
VRSSVPVARLQEQFPRQCKVGSPDHVKAIVNSSRTGVPLTPLRHVPAAIPLRLENQYFSLDVSHPLATEM
LQSGTCMFYVPGMLGEPELELFAVLRT
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|206575712|ref|NC_011283.1|:c3123331-3121988 Klebsiella pneumoniae 342 chromosome, complete genome
ATGATGAAAACGGAACGTCCGTTGTGGGGCCGGGGCATTATGGTGTCGCCCCAGCATTTTCAACAGCAGG
CTGCGTATGCAGCCTGGACTGCGGAAGTGATTGCCCGGATAGGTCTTAACCATCCATGGGGAGTGGTTGA
GGCGACCTTCGAACCAGAGATGCTTAAACTGGGCCGCCTGCAGGCTCACAGGCTGCAGGTCCGGTTCCAG
GATGGCACGATGATTGATACGGACAATGCCGATGCGCTGCCGTCCGCGCTGTCACTGGACGGCGCGGACG
GCGAGGCGGTGATCGTGCTGGCGCTGCCCCTGATGCAGGCGAATGGCGGCAACTGCCTGAAGCCGGAGGA
GGTGGCCGAAAGGCCGGTGCGCTTCCGGCAGCGCTGGCGCGATGTCCGCAACCAGTTCGGGGAAGATACC
CGACAGATTGCCGTCATGCAGCCGGAGCTGACCCTCCGTTTCGCCCATCAGGACAACAGCGATTACCTGA
CCTGTCCGCTTGTTCGCCTGCAGCGTGACTCGCAGGGGGCCTGGCTTATCGACGAGACGTTTCTCCCGCC
GCTGCTGCAGATCCAGGGCAGCCGCTGGCTGGCGACGCAGCTTGAACAGCTGCTCACCCAGCTTCGGGCT
CGTCTGACGCGCCTGATGGCCATGCGTCGCGAGAGTAATGAACGGATGGCTGATTTTGCCGTGGCCGATG
TCTCTCTGTTCTGGTTGCTGAACGCGCTGAACAGCGCCGAGCCGGTGCTGGGGTACTTTCTGCGTGACCA
ACAGAGCCCGCCGGAACGCCTCTATCCGGAGCTGGCGCGCCTGGCTGGCAGCCTGCTGACCTTTTCGCTT
ACCCATCAGGCGAATGCCGTCCCGATCTATCAGCATGACCATCTGAACGCGGTTTTTCCGCCGCTGTTTG
ATTTACTGAGCGACCTGCTGGAGGCGAGCCTGCCGTCGCGGGTGGTGGCGATTGCGCTGGAGCATGATGC
CCGGCTGCATTTCTGGCAGGCGCGCCTGCACGATGCCCGGCTGCGGGAAGGGGCTGATTACTACCTGTCG
GTTCGTTCGTCGGTACCGGTCGCCCGGCTGCAGGAGCAGTTTCCGCGACAGTGCAAAGTGGGCAGTCCGG
ATCATGTCAAAGCCATTGTCAACTCCTCGCGGACAGGGGTGCCCCTGACGCCATTGCGTCATGTGCCGGC
GGCGATCCCGCTACGTCTGGAAAATCAGTATTTCAGCCTCGATGTGTCCCACCCTCTGGCGACGGAAATG
CTGCAGAGCGGCACCTGTATGTTCTACGTCCCGGGGATGCTCGGTGAGCCTGAACTTGAACTTTTTGCGG
TACTACGAACGTGA