SecReT6
Protein ID: 206580906
SecReT6 ID304
T6SS typeN/A
Gene symbol-
Locus tagKPK_0935
StrainKlebsiella pneumoniae 342
Repliconchromosome [GenBank: NC_011283] [Browse all T6SS(s) in this replicon]
Location [Strand]942594..943019 [-]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDB5XUV8
KEGG IDkpe:KPK_0935
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.80E-16, Aligned region: 25..114
Protein Sequence: 141 a.a.     [Download]
>gi|206580906|ref|YP_002236807.1| unnamed protein product [Klebsiella pneumoniae 342]
MAASSLFEMLTFSFSGELPLEQVSERDQLILSVMDNMQRIINCRAGTLAHLPDYGLPDLSMIHQGMTAGI
HGLIHQIEKTLLRYEPRLSQLRVELQPQPRPGHLNYLIYAQLPDTGWIRFDGIFSAEGRIVLRHLKQQER
T
 
Nucleotide Sequence: 426 bp     [Download]
>gi|206575712|ref|NC_011283.1|:c943019-942594 Klebsiella pneumoniae 342 chromosome, complete genome
ATGGCAGCATCTTCTTTATTTGAAATGCTGACTTTCAGCTTCAGTGGTGAGCTGCCGCTGGAGCAGGTCA
GCGAGCGGGATCAGCTTATTCTCTCCGTTATGGACAACATGCAGCGCATCATCAACTGCCGGGCAGGAAC
GCTGGCGCATTTACCGGATTATGGTTTGCCGGACCTCAGCATGATTCATCAGGGAATGACCGCGGGTATT
CATGGTTTGATACACCAGATAGAAAAGACGTTACTGCGCTACGAACCCCGCCTGAGCCAGTTGCGCGTGG
AGTTGCAGCCGCAGCCCCGTCCGGGGCACCTTAATTATCTTATTTATGCCCAACTTCCCGATACCGGCTG
GATACGCTTTGATGGTATATTTTCTGCGGAAGGCCGGATTGTGCTGCGTCATCTCAAACAGCAGGAGCGC
ACGTGA